Property Summary

NCBI Gene PubMed Count 171
PubMed Score 795.99
PubTator Score 502.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Gene RIF (126)

PMID Text
26272182 Suggest a novel regulatory pathway whereby breast tumor-derived angiogenin directly activates angiogenesis through inhibition of miR-542-3p.
26255299 ANG K17I variant is rare in Caucasian patients and controls and increases the risk for amyotrophic lateral sclerosis
25659096 the present study established a link between Ang and FHL3 proteins and identifies a new pathway for regulating astrocytoma progression.
25604905 In conclusion, angiogenin secretion by HCCs favors tumor development by inducing HSC activation and ECM remodeling.
25564356 ANG could play a pivotal role in the development of bladder cancer through regulating AKT/mTOR signaling pathway.
25552400 Up-regulated ANG expression and increased nuclear translocation were observed in cervical cancers as compared to normal cervical tissues; upregulation of ANG was positively correlated with primary tumor invasion
25450558 Studied the mechanism of ligand binding in human angiogenin using the NMR chemical shift projection analysis.
25386690 ANG rs11701 variant is a genetic risk factor for Parkinson's disease in Taiwan population.Mutations in ANG are not a common cause for idiopathic Parkinson's disease.
25372031 a biological explanation for the loss-of-function of D22G-Angiogenin leading to ALS, and suggest that the L35P-Angiogenin mutation would probably cause ALS symptoms in individuals harboring this mutation
25193113 a novel mechanism of ANG in regulating PI3K/AKT/mTOR signaling pathway via RI, is reported.
25093183 The observed pattern of angiogenin expression is compatible with a role in blood vessel formation and in cross-talk between trophoblasts and endothelial cells.
25068345 Angiogenin was up-regulated in proliferative hemangiomas. Angiogenin serum levels correlate with the hemangioma stage. Angiogenin levels discriminate between proliferative hemangiomas and the control group and patients with venous malformations.
24696417 High angiogenin expression is associated with bladder cancer.
24659782 Data show that the transcription of angiogenin (ANG) and ribonuclease 4 (RNASE4) promoter is influenced by RNA polymerase III (Pol III) elements and could be differentially regulated by an intragenic CCCTC binding factor (CTCF)-dependent chromatin loop.
24603325 Amyloidogenic ApoA-I induces cell death is through attenuating anti-stress activity of angiogenin.
24561529 findings support an unrecognized interplay between ANG, ERK1/2 and MMP2 that can impact tumor growth and progression.
24457100 ANG interacts with plasminogen activation system at the leading edges of breast cancer cell surfaces and facilitates interactions of uPAR with uPA to regulate plasmin formation and cell migration.
24356419 Depletion of cellular ANG expression abolished PLSCR1-enhanced rRNA transcription.
24122807 These data suggest that one of the mechanisms by which ANG stimulates rRNA transcription is through an epigenetic activation of rDNA promoter.
23989187 Overexpression of ANG in pterygium body fibroblasts might be involved in active pterygium growth with thick pterygium body formation and increased risk of recurrence.
23977052 Nuclear ANG directly binds to the ANG-Binding Sequence within ERRgamma of ERRgamma gene and inhibits ERRgamma transcription to promote breast cancer cell proliferation.
23921786 Serum angiogenin levels may be useful to distinguish between cancer and noncancer patients among the candidates for prostatic biopsy in regular clinical practice.
23851444 Data shows ANG-stimulated rRNA transcription is not only an essential component for androgen-dependent growth of prostate cancer but also contributes to the transition of prostate cancer from androgen-dependent to castration-resistant growth status.
23665167 fast molecular dynamics based method for determining the mechanisms of functional loss caused by mutations
23409128 neuroprotective effects of angiogenin
23379493 Increased angiogenin may contribute to decreased T-cell zeta-chain expression in hemodialysis patients
23351638 Changes of angiogenin in the skin of patients with amyotrophic lateral sclerosis are related to the disease process.
23231972 Our data do not support the association of angiogenin variants with Parkinson's disease in Han Chinese of mainland China.
23229115 Dysregulated angiogenin expression may contribute to the pathogenesis of myositis as well as skin involvement via the vascular change in DM/CADM
22940420 analysis of Angiogenin in middle-aged type 1 diabetes patients
22694909 Angiogenin is up-regulated in the hypoxic environment of oral squamous cell carcinoma
22633874 findings suggest that the interaction between Ang and FHL3 may provide some clues to the mechanisms of Ang-regulated cell growth and apoptosis
22526325 serum angiogenin levels in cutaneous T cell lymphoma (CTCL)patients were significantly higher than healthy controls; angiogenin mRNA expression levels in lesional skin were elevated in erythrodermic CTCL compared to normal skin; results suggest enhanced angiogenin expression may be related with poor prognosis of erythrodermic CTCL
22449478 In Alzheimer disease, serum angiogenin was decreased and cognitive function was associated with correlated with angiogenin levels.
22438557 LANA-1 and ANG colocalize and coimmunoprecipitate in de novo infected endothelial cells and in latently infected PEL (BCBL-1 and BC-3) cells.
22384259 analysis of how loss of functions of human angiogenin variants are implicated in amyotrophic lateral sclerosis
22372545 Angiogenin up-regulation correlates with adverse clinicopathological and biological factors, increased microvascular density and poor patient outcome in neuroblastomas.
22292843 Results identify novel variants in SOD1, ANG, TARDBP and FUS, and expand the FUS-associated clinicopathologic phenotype of amyotrophic lateral sclerosis.
22292798 Angiogenin mutation may be involved in the aetiology of amyotrophic lateral sclerosis in the Han Chinese population.
22266868 Angiogenin interacts with p53 and colocalizes in the nucleus.
22194915 The existence of ANG in the cytoplasm optimizes stress fiber assembly and focal adhesion formation to accommodate cell migration.
22190368 The data from this multicenter study demonstrate that there is a strong association between Parkinson disease, amyotrophic lateral sclerosis, and Angiogenin(ag) variants. AG is a genetic link between amyotrophic lateral sclerosis and Parkinson disease .
22148849 At physiological pH, the prevailing complex species formed by the peptide encompassing the protein sequence 4-17 is [CuHL], in which the metal ion is bound to two imidazole and two deprotonated amide nitrogen atoms.
21919032 A significant positive correlation was observed between serum ANG and microvascular density in multiple myeloma patients. A complex network of cytokines induces bone marrow neovascularization in MM.
21808991 Data suggest that umbilical cord blood-derived endothelial progenitor cells are confined to CD14-/CD34+ subpopulation and angiogenin1 released from CD14+ subpopulation may be an important factor promoting the EPC colony formation.
21800332 Amniotic fluid angiogenin levels are decreased in pregnancies with fetal trisomy 21.
21778318 Angiogenic factors angiogenin, endoglin and endostatin show a definite relationship with disease stage in uterine cervical cancer, but are presently not suitable for use in risk stratification
21711968 increased expression in nasal polyps
21621297 This report confirms that clinical course of SOD1-related ALS may be modulated by ANG.
21539846 Patients with diabetic retinopathy had lower angiogenin concentrations in serum and vitreous samples than individuals without diabetic complications.
21528671 Findings suggest that there is a cooperation mechanism between basic fibroblast growth factor and angiogenin in A375 cells, and the cooperation mechanism affects the progress of tumor cell proliferation and angiogenesis.
21439815 serum angiogenin at diagnosis may have a role in failure on long-term treatment response and for poor overall survival in non-Hodgkin lymphoma
21375772 Data from microRNA and microarray analysis suggests dissimilar endometrial receptivity in patients with high P levels on the day of hCG, and elevated osteopontin and decreased VEGF had poor pregnancy rates.
21364907 Angiogenin was synthesized by the human choroid and retina and localized to normal and pathologic vasculature.
21209106 These studies suggest that Kaposi's sarcoma-associated herpesvirus has evolved to exploit ANG for its advantage via a so-far-unexplored PLC-gamma pathway for maintaining its latency.
21154263 Angiogenin is a novel marker of three-vessel coronary disease showing a relationship with the angiographic severity of the disease.
21103661 Vascular RNase1 and RNase5 are mainly produced by vascular endothelial cells and can serve, depending on the vascular bed, different functions in vascular homeostasis and endothelial cell responses.
21091473 Endogenous angiogenin present in two dopamine-producing human neuroblastoma cell lines protects against dopaminergic neuronal cell death and may have potential as therapy in a transgenic mouse model of Parkinson's disease.
21085671 Data show that ANG variants associate with ALS in the Irish and Swedish populations, but not in the Polish.
21085671 Observational study of gene-disease association. (HuGE Navigator)
20955379 Angiogenin expression in laryngeal carcinoma cells and CD105 expression can be considered as potentially useful to detect laryngeal squamous cell carcinoma patients with higher risk of disease recurrence
20952631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20923443 Considering ANG-mediated angiogenesis, statistical analysis on the basaloid SCC patients disclosed a trend toward a significant inverse correlation between ANG expression in the endothelial cells of intratumorperitumor vessels and disease-free survival
20838751 Report increased levels of angiogenin in acute coronary syndrome.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20629092 Elevated serum angiogenin is associated with inflammatory bowel disease.
20577002 Mutations in SOD1, ANG, VAPB, TARDBP and FUS genes have been identified in amyotrophic lateral sclerosis.
20577002 Observational study of gene-disease association. (HuGE Navigator)
20484129 Patients with poorly controlled type 2 diabetes (A1C >7%) have lower angiogenin levels than patients with well-controlled diabetes.
20472325 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20174961 Suggest that human ANG plays a critical role in cell protection and migration following alterations in ERK1/2 signaling in neuroblastoma cells.
20137109 VEGF may regulate Ang-2 expression and promote angiogenesis and acute leukemia development.
20105109 inverse correlation (p=0.07) with disease-free survival in nasopharyngeal carcinoma
20045391 Angiogenin may cause changes in the cell cytoskeleton by inhibiting polymerization of G-actin and changing the physical properties of F-actin.
19631914 endogenous basic fibroblast growth factor may not only negatively regulate the angiogenin expression but also contribute to the overall cell proliferation in H7402 human hepatoma cells
19625371 Human mast cells store and secrete angiogenin to a variety of stimul and suggest its availability in inflammation.
19423182 plays an active role in lung adenocarcinoma cell proliferation
19363631 Our results suggest that missense variants in the ANG gene play a role in ALS in the German population and provide further evidence to support the hypothesis that angiogenic factors up-regulated by hypoxia are involved in the pathophysiology of ALS.
19363631 Observational study of gene-disease association. (HuGE Navigator)
19332886 Angiogenin is required for stress-induced production of tiRNAs.
19287993 endogenous bFGF affects the expression of angiogenin in HeLa cells.
19262607 proteases contribute indirectly to the defense function of the stratum corneum by releasing the RNase inhibitor mediated inhibition of RNase 5 and RNase 7.
19253715 Observational study of gene-disease association. (HuGE Navigator)
19160530 Angiogenin was significantly higher in Chronic heart failure patients compared to controls;Angiogenin is related to worsening heart failure severity (NYHA classification)
19158252 The results suggest that by increasing infected endothelial cell 45S rRNA synthesis, proliferation, migration, and angiogenesis, Kaposi Sarcoma Associated Herpesvirus-induced angiogenin could be playing a pivotal role in the pathogenesis of infection.
18955785 angiogenin expression is decreased in the eutopic endometrium from women with advanced stage en
18936943 Angiogenin is expressed in human dermal papilla cells, where it might contribute to hair growth directly, by stimulating dermal papilla cells to proliferate, or indirectly, by inducing local vascularization.
18852347 Overall, our findings support the implication of ANG gene mutations as a rare but widespread cause of ALS.
18852347 Observational study of gene-disease association. (HuGE Navigator)
18808740 Results describe significant differences between controls and patients with renal cell carcinoma both pre-operatively and post-operatively in angiogenin, PDGF and MCP-1 serum levels.
18636464 In three continental population groups (Asia, Europe, Africa), the angiogenin and RNase 2 genes appear to exhibit markedly less genetic heterogeneity with regard to T195C and A238G (ANG) and C425A (RNASE2) SNPs.
18636464 Observational study of genotype prevalence. (HuGE Navigator)
18087731 identified seven different mutations, five of which are novel, in nine patients but not in 515 healthy controls. Three mutations are located in the signal peptide region, three in the coding sequence, and one in the 3' untranslated region.
18087731 Observational study of genotype prevalence. (HuGE Navigator)
17900154 Human ANG variants implicated in amyotrophic lateral sclerosis are characterized.
17886298 ANG mutations, identified in ALS patients, are associated with functional loss of ANG activity. Strong ANG expression, in normal spinal cord neurons and endothelial cells confirms plausibility of ANG dysfunction being relevant to pathogenesis of ALS.
17703939 Our finding supports the evidence that the ANG gene is involved in ALS.
17462671 Observational study of gene-disease association. (HuGE Navigator)
17462671 in conclusion, we did not detect the association with rs11701-G or with any other newly detected variation in the ANG regulatory region with amyotropic lateral sclerosis
17113198 Observational study of gene-disease association. (HuGE Navigator)
17113198 Absence of angiogenic genes not modification in Italian ALS patients.
16937522 ANG is one of the neovascularization factors of gastric carcinoma and may work in coordination with VEGF, and promote the proliferation of gastric carcinoma cells
16490744 Under hypoxic conditions, the ANG and VEGF secreted by renal proximal tubular epithelial cells may modulate angiogenesis and vascular remodeling in the renal interstitium via an increase in the production of HIF-1
16322296 Elevated expression of angiogenin is associated with prostate cancer
15979542 The present study demonstrates for the first time, differential expression of mRNA and secretion for angiogenin and VCAM-1 from placental explants and trophoblasts in culture subjected to hypoxia
15558023 Angiogenin-stimulated rRNA transcription in endothelial cells serves as a crossroad in the process of angiogenesis induced by various angiogenic factors.
15557516 In Irish amyotrophic lateral sclerosis patients, there was a significant allelic association with the rs11701 SNP & a new mutation (K40I) that potentially inhibits angiogenin function.
15236995 The inflammation associated with endometriosis, through increasing levels of peritoneal fluid angiogenin, might promote angiogenesis for progression of the disease and correlate with the extent of the disorder.
15182336 serum angiogenin levels although not increased in comparison with healthy controls, may predict clinical outcome of patients with early chronic lymphocytic leukemia and help to refine Rai's stratification
15166501 The distribution of ANG was studied in term placenta and by its expression in cultured trophoblastic cells.
15128420 elevated blood levels of angiogenin feature chronic myeloid malignancies, suggesting a role of angiogenin in the pathogenesis of these diseases
15067362 Finb functions as a sequence-specific transcriptional repressor of the hANG gene
15064314 The specific localization of angiogenin in peritubular myoid cells suggests that angiogenin plays physiologic roles in the human testis.
14671622 Compared with controls, patients with multiple myeloma show elevated serum levels.
14593238 in umbilical cord plasma, a developmental increase was evident in concentrations of vascular endothelial growth factor(VEGF) and angiogenin during the last trimester of gestation, and VEGF level was lower in term fetuses born to mothers with diabetes
12705339 High serum angiogenin levels were associated with choriocarcinoma
12548285 Human angiogenin has antimicrobial activity against C. albicans and S. pneumoniae.
12515546 An angiogenin-binding DNA sequence (CTCTCTCTCTCTCTCTCCCTC) has been identified from the nontranscribed region of rRNA gene and characterized as possessing angiogenin-dependent promoter activity that directs the expression of a luciferase reporter gene.
12209593 Serum levels of angiogenin, basic fibroblast growth factor and endostatin in patients receiving intensive chemotherapy for acute myelogenous leukemia.
12168899 Distribution of angiogenin and its gene message in colorectal cancer patients has clinical relevance.
11984825 Expression and localization of angiogenin in placenta; enhanced levels at term over first trimester villi
11851402 role of C-terminal fragment in defining enzymatic potency
11847008 Blood levels are elevated in myelodysplastic syndromes and in acute myeloid leukemia.
11782452 Here we report that chANG, an antiangiogenin peptide, binds to the actin-binding site of angiogenin
11374889 nucleolar localization; nucleolar signal peptide

AA Sequence

MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFI      1 - 70
HGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLD     71 - 140
QSIFRRP                                                                   141 - 147
//

Text Mined References (175)

PMID Year Title
26272182 2015 Tumor cell-secreted angiogenin induces angiogenic activity of endothelial cells by suppressing miR-542-3p.
26255299 2015 Association between the Angiogenin (ANG) K17I variant and amyotrophic lateral sclerosis risk in Caucasian: a meta-analysis.
25659096 2015 Angiogenin promotes U87MG cell proliferation by activating NF-?B signaling pathway and downregulating its binding partner FHL3.
25604905 2015 Angiogenin secretion from hepatoma cells activates hepatic stellate cells to amplify a self-sustained cycle promoting liver cancer.
25564356 2015 Downregulation of angiogenin inhibits the growth and induces apoptosis in human bladder cancer cells through regulating AKT/mTOR signaling pathway.
25552400 2015 Pharmacokinetics of neamine in rats and anti-cervical cancer activity in vitro and in vivo.
25450558 2015 Network of long-range concerted chemical shift displacements upon ligand binding to human angiogenin.
25386690 2014 Mutational analysis of angiogenin gene in Parkinson's disease.
25372031 2014 Computational and functional characterization of Angiogenin mutations, and correlation with amyotrophic lateral sclerosis.
25193113 2014 Angiogenin interacts with ribonuclease inhibitor regulating PI3K/AKT/mTOR signaling pathway in bladder cancer cells.
25093183 2014 Angiogenin expression during early human placental development; association with blood vessel formation.
25068345 2014 Angiogenin: a potential serum marker of infantile hemangioma revealed by cDNA microarray analysis.
24696417 2014 Diagnostic evaluation of urinary angiogenin (ANG) and clusterin (CLU) as biomarker for bladder cancer.
24659782 2014 Transcription of angiogenin and ribonuclease 4 is regulated by RNA polymerase III elements and a CCCTC binding factor (CTCF)-dependent intragenic chromatin loop.
24603325 2014 Amyloidogenic variant of apolipoprotein A-I elicits cellular stress by attenuating the protective activity of angiogenin.
24561529 2015 Angiogenin promotes tumoral growth and angiogenesis by regulating matrix metallopeptidase-2 expression via the ERK1/2 pathway.
24457100 2014 Angiogenin interacts with the plasminogen activation system at the cell surface of breast cancer cells to regulate plasmin formation and cell migration.
24356419 2013 Phospholipid scramblase 1 functionally interacts with angiogenin and regulates angiogenin-enhanced rRNA transcription.
24337645 2014 Comparative genomic analysis of eutherian ribonuclease A genes.
24122807 2014 Angiogenin stimulates ribosomal RNA transcription by epigenetic activation of the ribosomal DNA promoter.
23989187 2013 Overexpression of angiogenin in pterygium body fibroblasts and its association with proliferative potency.
23977052 2013 Identification of estrogen receptor-related receptor gamma as a direct transcriptional target of angiogenin.
23921786 2014 Can serum angiogenin be used to improve the diagnostic performance in prostate cancer screening?
23851444 2013 Angiogenin mediates androgen-stimulated prostate cancer growth and enables castration resistance.
23665167 2013 Fast prediction of deleterious angiogenin mutations causing amyotrophic lateral sclerosis.
23409128 2013 Angiogenin in Parkinson disease models: role of Akt phosphorylation and evaluation of AAV-mediated angiogenin expression in MPTP treated mice.
23379493 2013 Increased plasma angiogenin level is associated and may contribute to decreased T-cell zeta-chain expression in hemodialysis patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23351638 2013 Immunohistochemical studies of angiogenin in the skin of patients with amyotrophic lateral sclerosis.
23231972 2013 Angiogenin variants are not associated with Parkinson's disease in the ethnic Chinese population.
23229115 2012 Angiogenin expression in the sera and skin of patients with rheumatic diseases.
22940420 2012 Angiogenin in middle-aged type 1 diabetes patients.
22694909 2012 Hypoxia-induced up-regulation of angiogenin, besides VEGF, is related to progression of oral cancer.
22633874 2012 Identification and characterization of FHL3 as a novel angiogenin-binding partner.
22526325 2012 Angiogenin levels are increased in lesional skin and sera in patients with erythrodermic cutaneous T cell lymphoma.
22449478 2012 Decreased serum angiogenin level in Alzheimer's disease.
22438557 2012 Kaposi's sarcoma-associated herpesvirus latency-associated nuclear antigen interacts with multifunctional angiogenin to utilize its antiapoptotic functions.
22384259 2012 Mechanisms of loss of functions of human angiogenin variants implicated in amyotrophic lateral sclerosis.
22372545 2012 Angiogenin up-regulation correlates with adverse clinicopathological and biological factors, increased microvascular density and poor patient outcome in neuroblastomas.
22292843 2012 SOD1, ANG, TARDBP and FUS mutations in amyotrophic lateral sclerosis: a United States clinical testing lab experience.
22292798 2012 Identification of a novel missense mutation in angiogenin in a Chinese amyotrophic lateral sclerosis cohort.
22266868 2012 Angiogenin functionally interacts with p53 and regulates p53-mediated apoptosis and cell survival.
22194915 2011 Angiogenin enhances cell migration by regulating stress fiber assembly and focal adhesion dynamics.
22190368 2011 Angiogenin variants in Parkinson disease and amyotrophic lateral sclerosis.
22148849 2012 Probing the copper(II) binding features of angiogenin. Similarities and differences between a N-terminus peptide fragment and the recombinant human protein.
21919032 2012 Role of platelet-derived growth factor-AB in tumour growth and angiogenesis in relation with other angiogenic cytokines in multiple myeloma.
21855800 2011 Angiogenin-induced tRNA fragments inhibit translation initiation.
21808991 2012 CD14-/CD34+ is the founding population of umbilical cord blood-derived endothelial progenitor cells and angiogenin1 is an important factor promoting the colony formation.
21800332 2011 Amniotic fluid angiogenin levels are decreased in pregnancies with fetal trisomy 21.
21778318 2011 Prognostic significance of the angiogenic factors angiogenin, endoglin and endostatin in cervical cancer.
21711968 Increased expression of angiogenin in nasal polyps.
21621297 2011 SOD1 G93D sporadic amyotrophic lateral sclerosis (SALS) patient with rapid progression and concomitant novel ANG variant.
21539846 2011 Decreased angiogenin concentration in vitreous and serum in proliferative diabetic retinopathy.
21528671 Basic fibroblast growth factor affects the expression of angiogenin and cell proliferation in A375 human melanoma cells.
21439815 2011 High serum angiogenin at diagnosis predicts for failure on long-term treatment response and for poor overall survival in non-Hodgkin lymphoma.
21375772 2011 MicroRNA array and microarray evaluation of endometrial receptivity in patients with high serum progesterone levels on the day of hCG administration.
21364907 2011 Angiogenin in age-related macular degeneration.
21209106 2011 Kaposi's sarcoma-associated herpesvirus-induced angiogenin plays roles in latency via the phospholipase C gamma pathway: blocking angiogenin inhibits latent gene expression and induces the lytic cycle.
21154263 2010 Relationship of serum angiogenin, adiponectin and resistin levels with biochemical risk factors and the angiographic severity of three-vessel coronary disease.
21103661 2011 Expression and localisation of vascular ribonucleases in endothelial cells.
21091473 2011 A neuroprotective role for angiogenin in models of Parkinson's disease.
21085671 2010 Angiogenin levels and ANG genotypes: dysregulation in amyotrophic lateral sclerosis.
20955379 2010 Neoangiogenesis in laryngeal carcinoma: angiogenin and CD105 expression is related to carcinoma recurrence rate and disease-free survival.
20952631 2010 Association of single-nucleotide polymorphisms from 17 candidate genes with baseline symptom-limited exercise test duration and decrease in duration over 20 years: the Coronary Artery Risk Development in Young Adults (CARDIA) fitness study.
20923443 2011 Angiogenin expression in head and neck basaloid and conventional squamous cell carcinoma: a site- and stage-matched comparison.
20838751 2010 Plasma haemoxygenase-1 in coronary artery disease. A comparison with angiogenin, matrix metalloproteinase-9, tissue inhibitor of metalloproteinase-1 and vascular endothelial growth factor.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20629092 2011 Angiogenin, angiopoietin-1, angiopoietin-2, and endostatin serum levels in inflammatory bowel disease.
20577002 2010 SOD1, ANG, VAPB, TARDBP, and FUS mutations in familial amyotrophic lateral sclerosis: genotype-phenotype correlations.
20484129 2010 Glycemic control influences serum angiogenin concentrations in patients with type 2 diabetes.
20472325 2011 FUS, TARDBP, and SOD1 mutations in a Taiwanese cohort with familial ALS.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20174961 2010 Human angiogenin presents neuroprotective and migration effects in neuroblastoma cells.
20137109 2010 [Expression of angiogenin-2 and VEGF in acute leukemia and its significance].
20105109 2010 Expression of MASPIN and angiogenin in nasopharyngeal carcinoma: novel preliminary clinico-pathological evidence.
20045391 2010 Binding of human angiogenin inhibits actin polymerization.
19631914 2009 Effects of basic fibroblast growth factor on angiogenin expression and cell proliferation in H7402 human hepatoma cells.
19625371 2009 Human mast cells synthesize and release angiogenin, a member of the ribonuclease A (RNase A) superfamily.
19423182 2009 Angiogenin is involved in lung adenocarcinoma cell proliferation and angiogenesis.
19363631 2009 Identification of novel Angiogenin (ANG) gene missense variants in German patients with amyotrophic lateral sclerosis.
19354288 2009 Ribonuclease inhibitor regulates neovascularization by human angiogenin.
19332886 2009 Angiogenin cleaves tRNA and promotes stress-induced translational repression.
19287993 2009 Influence of basic fibroblast growth factor on the growth of HeLa cells and the expression of angiogenin.
19262607 2009 Degradation by stratum corneum proteases prevents endogenous RNase inhibitor from blocking antimicrobial activities of RNase 5 and RNase 7.
19253715 2009 [Genetic determinants of cardiovascular remodeling in Uzbek patients with essential hypertension].
19160530 2008 Elevated angiogenin levels in chronic heart failure.
19158252 2009 Kaposi's sarcoma-associated herpesvirus upregulates angiogenin during infection of human dermal microvascular endothelial cells, which induces 45S rRNA synthesis, antiapoptosis, cell proliferation, migration, and angiogenesis.
18955785 2008 Decreased expression of angiogenin in the eutopic endometrium from women with advanced stage endometriosis.
18936943 2009 Angiogenin is expressed in human dermal papilla cells and stimulates hair growth.
18852347 2008 Mutations of the ANG gene in French patients with sporadic amyotrophic lateral sclerosis.
18808740 2008 Determination of angiogenic factors in serum by protein array in patients with renal cell carcinoma.
18636464 2008 Three single nucleotide polymorphisms leading to non-synonymous amino acid substitution in the human ribonuclease 2 and angiogenin genes exhibit markedly less genetic heterogeneity in six populations.
18087731 2008 Identification of new ANG gene mutations in a large cohort of Italian patients with amyotrophic lateral sclerosis.
17991437 2007 Identification and characterization of follistatin as a novel angiogenin-binding protein.
17900154 2007 Characterization of human angiogenin variants implicated in amyotrophic lateral sclerosis.
17886298 2007 Angiogenin loss-of-function mutations in amyotrophic lateral sclerosis.
17703939 2008 A novel Angiogenin gene mutation in a sporadic patient with amyotrophic lateral sclerosis from southern Italy.
17462671 2007 Variations in the coding and regulatory sequences of the angiogenin (ANG) gene are not associated to ALS (amyotrophic lateral sclerosis) in the Italian population.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17125737 2007 Angiogenin-induced protein kinase B/Akt activation is necessary for angiogenesis but is independent of nuclear translocation of angiogenin in HUVE cells.
17113198 2008 Absence of angiogenic genes modification in Italian ALS patients.
16937522 2006 Increased expression of angiogenin in gastric carcinoma in correlation with tumor angiogenesis and proliferation.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16567967 2006 Influence of angiogenin on the growth of A375 human melanoma cells and the expression of basic fibroblast growth factor.
16501576 2006 ANG mutations segregate with familial and 'sporadic' amyotrophic lateral sclerosis.
16490744 2006 Hypoxic conditions stimulate the production of angiogenin and vascular endothelial growth factor by human renal proximal tubular epithelial cells in culture.
16461950 2005 Assessment of some tools for the characterization of the human osteoarthritic cartilage proteome.
16322296 2005 Elevated expression of angiogenin in prostate cancer and its precursors.
15979542 2005 Hypoxia up-regulated angiogenin and down-regulated vascular cell adhesion molecule-1 expression and secretion in human placental trophoblasts.
15776477 2005 Angiogenin is up-regulated in the nucleus and cytoplasm in human primary breast carcinoma and is associated with markers of hypoxia but not survival.
15737636 2005 Alpha-actinin-2, a cytoskeletal protein, binds to angiogenin.
15735021 2005 Angiogenin is translocated to the nucleus of HeLa cells and is involved in ribosomal RNA transcription and cell proliferation.
15558023 2005 Endogenous angiogenin in endothelial cells is a general requirement for cell proliferation and angiogenesis.
15557516 2004 A novel candidate region for ALS on chromosome 14q11.2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15236995 2004 Elevated angiogenin levels in the peritoneal fluid of women with endometriosis correlate with the extent of the disorder.
15182336 2004 Serum angiogenin is not elevated in patients with early B-cell chronic lymphocytic leukemia but is prognostic factor for disease progression.
15166501 2003 Angiogenin distribution in human term placenta, and expression by cultured trophoblastic cells.
15128420 2004 Levels of soluble angiogenin in chronic myeloid malignancies: clinical implications.
15067362 2004 Finb, a multiple zinc finger protein, represses transcription of the human angiotensinogen gene.
15064314 Evidence for the presence of angiogenin in human testis.
14756559 2004 Crystallographic studies on structural features that determine the enzymatic specificity and potency of human angiogenin: Thr44, Thr80, and residues 38-41.
14671622 2003 Elevated serum angiogenin in multiple myeloma.
14593238 2003 Vascular endothelial growth factor and angiogenin levels during fetal development and in maternal diabetes.
12842050 2003 The crystal structure of human angiogenin in complex with an antitumor neutralizing antibody.
12770725 2003 Production of vascular endothelial growth factor and angiogenic factor in human follicular fluid.
12705339 2003 Angiogenin and gestational trophoblastic tumors, a promising prognostic marker.
12548285 2003 Angiogenins: a new class of microbicidal proteins involved in innate immunity.
12515546 2003 Identification and characterization of an angiogenin-binding DNA sequence that stimulates luciferase reporter gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209593 2002 Serum levels of angiogenin, basic fibroblast growth factor and endostatin in patients receiving intensive chemotherapy for acute myelogenous leukemia.
12168899 Distribution of angiogenin and its gene message in colorectal cancer patients and their clinical relevance.
12051708 2002 The nuclear function of angiogenin in endothelial cells is related to rRNA production.
11984825 2002 Expression and localization of angiogenin in placenta: enhanced levels at term over first trimester villi.
11919285 2002 Diversifying selection of the tumor-growth promoter angiogenin in primate evolution.
11851402 2002 Crystallographic studies on the role of the C-terminal segment of human angiogenin in defining enzymatic potency.
11847008 2002 Blood levels of angiogenin and vascular endothelial growth factor are elevated in myelodysplastic syndromes and in acute myeloid leukemia.
11782452 2002 Antiplasmin activity of a peptide that binds to the receptor-binding site of angiogenin.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11751393 2001 Human angiogenin fused to human CD30 ligand (Ang-CD30L) exhibits specific cytotoxicity against CD30-positive lymphoma.
11468363 2001 Binding of phosphate and pyrophosphate ions at the active site of human angiogenin as revealed by X-ray crystallography.
11438326 2001 Concentrations of angiogenic factors in follicular fluid and oocyte-cumulus complex culture medium from women undergoing in vitro fertilization: association with oocyte maturity and fertilization.
11374889 2001 Novel properties of the nucleolar targeting signal of human angiogenin.
10999833 2000 Evidence for the presence of angiogenin in human follicular fluid and the up-regulation of its production by human chorionic gonadotropin and hypoxia.
10649442 2000 Human angiogenin is rapidly translocated to the nucleus of human umbilical vein endothelial cells and binds to DNA.
10648935 1999 Antitransferrin receptor antibody-RNase fusion protein expressed in the mammary gland of transgenic mice.
10413501 1999 Superadditive and subadditive effects of "hot spot" mutations within the interfaces of placental ribonuclease inhibitor with angiogenin and ribonuclease A.
10103013 1999 Expression of receptors for human angiogenin in vascular smooth muscle cells.
9918722 1999 Refined crystal structures of native human angiogenin and two active site variants: implications for the unique functional properties of an enzyme involved in neovascularisation during tumour growth.
9707554 1998 Neomycin inhibits angiogenin-induced angiogenesis.
9461294 1997 Three-dimensional solution structure of human angiogenin determined by 1H,15N-NMR spectroscopy--characterization of histidine protonation states and pKa values.
9311977 1997 Molecular recognition of human angiogenin by placental ribonuclease inhibitor--an X-ray crystallographic study at 2.0 A resolution.
9245697 1997 Interaction of human angiogenin with copper modulates angiogenin binding to endothelial cells.
9122172 1997 A putative angiogenin receptor in angiogenin-responsive human endothelial cells.
9050852 1997 Site-specific mutagenesis reveals differences in the structural bases for tight binding of RNase inhibitor to angiogenin and RNase A.
8448182 1993 Characterization and sequencing of rabbit, pig and mouse angiogenins: discernment of functionally important residues and regions.
8159679 1994 Crystal structure of human angiogenin reveals the structural basis for its functional divergence from ribonuclease.
8127865 1994 Nuclear translocation of angiogenin in proliferating endothelial cells is essential to its angiogenic activity.
7945327 1994 Identification of the nucleolar targeting signal of human angiogenin.
7679494 1993 Actin is a binding protein for angiogenin.
3663649 1987 Isolation of angiogenin from normal human plasma.
3619929 1987 Angiogenin mRNA in human tumor and normal cells.
3470787 1987 Human placental ribonuclease inhibitor abolishes both angiogenic and ribonucleolytic activities of angiogenin.
2866795 1985 Sequence of the cDNA and gene for angiogenin, a human angiogenesis factor.
2866794 1985 Amino acid sequence of human tumor derived angiogenin.
2742853 1989 Binding of placental ribonuclease inhibitor to the active site of angiogenin.
2730651 1989 Characterization of ribonucleolytic activity of angiogenin towards tRNA.
2646638 1989 Angiogenin stimulates endothelial cell prostacyclin secretion by activation of phospholipase A2.
2479414 1989 Site-directed mutagenesis of histidine-13 and histidine-114 of human angiogenin. Alanine derivatives inhibit angiogenin-induced angiogenesis.
2457905 1988 Angiogenin activates endothelial cell phospholipase C.
2440105 1987 Tissue distribution and developmental expression of the messenger RNA encoding angiogenin.
2424496 1986 Characteristic ribonucleolytic activity of human angiogenin.
2276743 1990 The placental ribonuclease inhibitor (RNH) gene is located on chromosome subband 11p15.5.
1978563 1990 Localization of the human angiogenin gene to chromosome band 14q11, proximal to the T cell receptor alpha/delta locus.
1400510 1992 Angiogenin is a cytotoxic, tRNA-specific ribonuclease in the RNase A superfamily.