Property Summary

NCBI Gene PubMed Count 37
PubMed Score 1.40
PubTator Score 9.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 2.4e-03
osteosarcoma -1.184 2.9e-04
Pick disease -1.300 1.1e-05

 GO Function (1)

PDB (10)

Gene RIF (7)

AA Sequence

MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLLLTMSNNNPEL      1 - 70
FSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSASTPQSQCLPSEIEVKY     71 - 140
KMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQERPSVTSYKEVLRQCPLALDAILGLL    141 - 210
SLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADL    211 - 280
YFRAGDNKNSVLKFEQAQMLDPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSF    281 - 350
YSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLAS    351 - 420
NSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQ    421 - 490
KYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMEKEESPTD    491 - 560
ATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ                                   561 - 599
//

Text Mined References (43)

PMID Year Title