Property Summary

NCBI Gene PubMed Count 30
PubMed Score 27.17
PubTator Score 13.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
interstitial lung disease 1.300 3.0e-03
astrocytic glioma 1.600 8.0e-03
ependymoma 1.200 2.6e-02
oligodendroglioma 1.700 5.7e-03
psoriasis 1.200 6.2e-05
osteosarcoma 3.852 1.9e-07
medulloblastoma 1.500 3.7e-03
non diabetic and post-ischemic heart fai... 1.300 1.4e-02
atypical teratoid / rhabdoid tumor 1.300 2.6e-04
glioblastoma 1.500 1.2e-03
medulloblastoma, large-cell 2.100 6.8e-05
juvenile dermatomyositis 1.360 2.6e-11
acute quadriplegic myopathy 1.321 4.8e-06
adrenocortical carcinoma 1.583 7.1e-06
pancreatic ductal adenocarcinoma liver m... 1.507 4.0e-03
lung cancer 1.400 1.4e-04
diabetes mellitus 2.500 1.3e-03
lung adenocarcinoma 1.100 2.0e-03
non primary Sjogren syndrome sicca -1.500 1.1e-02
lung carcinoma 1.900 2.8e-07
non-small cell lung carcinoma 1.200 1.1e-07
Pick disease -1.600 3.4e-05
mucosa-associated lymphoid tissue lympho... -1.280 7.8e-03
ovarian cancer -2.400 1.3e-08
Gaucher disease type 1 -1.500 2.5e-02

 GO Function (1)

Gene RIF (4)

PMID Text
20686030 Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.
19826416 Studies indicate that APC/C(Cdh1) is required to maintain genomic stability.
16319895 APC5 and APC7 suppress E1A-mediated transformation in a CBP/p300-dependent manner, indicating that these components of the APC/C may be targeted during cellular transformation
15082755 Results show that Apc5 binds the poly(A) binding protein (PABP), which directly binds the internal ribosome entry site (IRES) element of platelet-derived growth factor 2 mRNA.

AA Sequence

MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRLNQLLLPLLQG      1 - 70
PDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFSGTEPEVHKTSVVGLFLRHMI     71 - 140
LAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSVREEEVSCSGPLSQK    141 - 210
QAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDR    211 - 280
LILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVL    281 - 350
GQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI    351 - 420
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVL    421 - 490
KHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEA    491 - 560
HKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVLNLAFA    561 - 630
QLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNY    631 - 700
FAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL                   701 - 755
//

Text Mined References (38)

PMID Year Title
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21307936 2011 Structural basis for the subunit assembly of the anaphase-promoting complex.
21269460 2011 Initial characterization of the human central proteome.
21241890 2011 Nuclear PTEN regulates the APC-CDH1 tumor-suppressive complex in a phosphatase-independent manner.
20686030 2010 Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.
19826416 2010 The emerging role of APC/CCdh1 in controlling differentiation, genomic stability and tumor suppression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16861917 2006 Cross-talk between APC/C and CBP/p300.
16541075 2006 The finished DNA sequence of human chromosome 12.
16364912 2005 Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C.
16319895 2005 The APC/C and CBP/p300 cooperate to regulate transcription and cell-cycle progression.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15082755 2004 The Apc5 subunit of the anaphase-promoting complex/cyclosome interacts with poly(A) binding protein and represses internal ribosome entry site-mediated translation.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14657031 2003 Mitotic regulation of the human anaphase-promoting complex by phosphorylation.
14593737 2003 The mitotic checkpoint: a signaling pathway that allows a single unattached kinetochore to inhibit mitotic exit.
12956947 2003 TPR subunits of the anaphase-promoting complex mediate binding to the activator protein CDH1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070128 2002 Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.
11742988 2001 APC/C-mediated destruction of the centrosomal kinase Nek2A occurs in early mitosis and depends upon a cyclin A-type D-box.
11535616 2001 Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.
11401522 2001 Expression of anaphase-promoting complex 5 in balloon angioplasty-injured rat carotid arteries and mitogen-stimulated human vascular smooth muscle cells.
11340163 2001 A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
10922056 2000 The RING-H2 finger protein APC11 and the E2 enzyme UBC4 are sufficient to ubiquitinate substrates of the anaphase-promoting complex.
10793135 2000 Mitotic regulation of the APC activator proteins CDC20 and CDH1.
10548110 1999 Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.
10500174 1999 Expression of the CDH1-associated form of the anaphase-promoting complex in postmitotic neurons.
10318877 1999 Characterization of the DOC1/APC10 subunit of the yeast and the human anaphase-promoting complex.
9469815 1998 Identification of a cullin homology region in a subunit of the anaphase-promoting complex.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.