Property Summary

NCBI Gene PubMed Count 28
PubMed Score 0.13
PubTator Score 13.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.771 3.5e-05
intraductal papillary-mucinous adenoma (... 1.200 3.9e-03
ovarian cancer -2.400 1.2e-14

Gene RIF (2)

PMID Text
20686030 Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.
19826416 Studies indicate that APC/C(Cdh1) is required to maintain genomic stability.

AA Sequence

MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPPNENTGKEVTC      1 - 70
LAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTVESSVLTSFYNAEDESNLLLP     71 - 140
KLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGGSSGFIELYAYGMFKIARVTGIAGTCLALCL    141 - 210
SSDLKSLSVVTEVSTNGASEVSYFQLETNLLYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEIL    211 - 280
MQMDSRLTKFVQEKNTTTSVQDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVIS    281 - 350
HLQSGSESLLYHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRW    351 - 420
LYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPP    421 - 490
NTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKPADVIGKSMNQAICIPLYRDT    491 - 560
RSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCILRRHTDISQSVSNGLIAIKFGSFTYATTEK    561 - 630
VRRSIYSCLDAQFYDDETVTVVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAI    631 - 700
PTRTMHFEKHWRLLESMKAQYVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVK    701 - 770
IKEEVLSESEAENQQAGAAALAPEIVIKVEKLDPELDS                                    771 - 808
//

Text Mined References (36)

PMID Year Title
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23288039 2013 Mechanisms controlling the temporal degradation of Nek2A and Kif18A by the APC/C-Cdc20 complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21926987 2011 APC15 drives the turnover of MCC-CDC20 to make the spindle assembly checkpoint responsive to kinetochore attachment.
21241890 2011 Nuclear PTEN regulates the APC-CDH1 tumor-suppressive complex in a phosphatase-independent manner.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20686030 2010 Inactivation and disassembly of the anaphase-promoting complex during human cytomegalovirus infection is associated with degradation of the APC5 and APC4 subunits and does not require UL97-mediated phosphorylation of Cdh1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19826416 2010 The emerging role of APC/CCdh1 in controlling differentiation, genomic stability and tumor suppression.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16364912 2005 Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684825 2003 Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays.
14657031 2003 Mitotic regulation of the human anaphase-promoting complex by phosphorylation.
14593737 2003 The mitotic checkpoint: a signaling pathway that allows a single unattached kinetochore to inhibit mitotic exit.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070128 2002 Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.
11742988 2001 APC/C-mediated destruction of the centrosomal kinase Nek2A occurs in early mitosis and depends upon a cyclin A-type D-box.
11535616 2001 Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.
11340163 2001 A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
10922056 2000 The RING-H2 finger protein APC11 and the E2 enzyme UBC4 are sufficient to ubiquitinate substrates of the anaphase-promoting complex.
10793135 2000 Mitotic regulation of the APC activator proteins CDC20 and CDH1.
10548110 1999 Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.
10500174 1999 Expression of the CDH1-associated form of the anaphase-promoting complex in postmitotic neurons.
10318877 1999 Characterization of the DOC1/APC10 subunit of the yeast and the human anaphase-promoting complex.
9469815 1998 Identification of a cullin homology region in a subunit of the anaphase-promoting complex.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
6180011 1982 Two subgroups of HLA Bw44 defined by cell-mediated lympholysis that differ in Bw44 expression on platelets and in patterns of genetic linkage disequilibrium.