Property Summary

NCBI Gene PubMed Count 28
PubMed Score 1.78
PubTator Score 0.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
glioblastoma 5572 2.5e-05
oligodendroglioma 2849 1.6e-03
ependymoma 2514 1.8e-03

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.500 1.8e-03
oligodendroglioma 1.300 1.6e-03
glioblastoma 1.100 2.5e-05

Gene RIF (8)

PMID Text
24804778 The regulation of Mdm2 by the E3 ubiquitin ligase APC/C is shown. It has important therapeutic implications for tumors with Mdm2 overexpression.
22190034 HIV-1 PR is identified to have a physical interaction with anaphase promoting complex subunit 2 (ANAPC2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21903591 anaphase-promoting complex (APC)-2-cell cycle and apoptosis regulatory protein (CARP)-1 interaction antagonists are novel regulators of cell growth and apoptosis
21768287 It proposes a role for APC/C(Cdh1) in modulating the status of PCNA monoubiquitination and UV DNA repair before S phase entry.
18976975 Knockdown of anaphase promoting complex subunit 2 (ANAPC2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18854154 Knockdown of anaphase promoting complex subunit 2 (ANAPC2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16364912 Results describe the locations of Cdh1 and Apc2 in the anaphase-promoting complex/cyclosome of human and Xenopus laevis.
11739784 APC2 Cullin protein and APC11 RING protein comprise the minimal ubiquitin ligase module of the anaphase-promoting complex.

AA Sequence

MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSV      1 - 70
LEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGL     71 - 140
LMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARR    141 - 210
RYYRLLQSPLCAGCSSDKQQCWCRQALEQFHQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGE    211 - 280
YERSFLREFHKWIERVVGWLGKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRD    281 - 350
FPDSRPAIEDLKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVA    351 - 420
CEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDWVPDPVDADPG    421 - 490
KSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVM    491 - 560
LKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALEAYCKKYEQLK    561 - 630
AMRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWL    631 - 700
QQGVLREEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSL    701 - 770
DRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS                      771 - 822
//

Text Mined References (37)

PMID Year Title
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
24804778 2014 The anaphase-promoting complex/cyclosome is an E3 ubiquitin ligase for Mdm2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21903591 2011 Antagonists of anaphase-promoting complex (APC)-2-cell cycle and apoptosis regulatory protein (CARP)-1 interaction are novel regulators of cell growth and apoptosis.
21768287 2011 APC/CCdh1-dependent proteolysis of USP1 regulates the response to UV-mediated DNA damage.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16364912 2005 Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14657031 2003 Mitotic regulation of the human anaphase-promoting complex by phosphorylation.
14593737 2003 The mitotic checkpoint: a signaling pathway that allows a single unattached kinetochore to inhibit mitotic exit.
14508008 2003 The Arabidopsis anaphase-promoting complex or cyclosome: molecular and genetic characterization of the APC2 subunit.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12070128 2002 Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.
11742988 2001 APC/C-mediated destruction of the centrosomal kinase Nek2A occurs in early mitosis and depends upon a cyclin A-type D-box.
11739784 2001 APC2 Cullin protein and APC11 RING protein comprise the minimal ubiquitin ligase module of the anaphase-promoting complex.
11691822 2001 Human APC2 localization and allelic imbalance.
11535616 2001 Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.
11340163 2001 A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
10922056 2000 The RING-H2 finger protein APC11 and the E2 enzyme UBC4 are sufficient to ubiquitinate substrates of the anaphase-promoting complex.
10793135 2000 Mitotic regulation of the APC activator proteins CDC20 and CDH1.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
10548110 1999 Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.
10500174 1999 Expression of the CDH1-associated form of the anaphase-promoting complex in postmitotic neurons.
10318877 1999 Characterization of the DOC1/APC10 subunit of the yeast and the human anaphase-promoting complex.
9469815 1998 Identification of a cullin homology region in a subunit of the anaphase-promoting complex.