Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.87
PubTator Score 2.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.4e-07
malignant mesothelioma 3163 2.1e-05
Multiple myeloma 1327 9.2e-03
Breast cancer 3098 4.7e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.081 9.2e-03
malignant mesothelioma 1.600 2.1e-05
Breast cancer 2.100 4.7e-02
ovarian cancer -1.800 1.4e-07

Synonym

Accession Q9BS18 Q9Y3V0 APC13
Symbols SWM1
APC13

Gene

PDB

4UI9   5G04   5KHR   5LCW  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
20846217 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVP      1 - 70
PIGN                                                                       71 - 74
//

Text Mined References (15)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
20846217 2010 Association of linear growth impairment in pediatric Crohn's disease and a known height locus: a pilot study.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
18391952 2008 Genome-wide association analysis identifies 20 loci that influence adult height.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16364912 2005 Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15060174 2004 Swm1/Apc13 is an evolutionarily conserved subunit of the anaphase-promoting complex stabilizing the association of Cdc16 and Cdc27.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.