Property Summary

Ligand Count 8
NCBI Gene PubMed Count 46
PubMed Score 824.25
PubTator Score 53.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Diabetes mellitus type 2 69
Disease Target Count P-value
psoriasis 6694 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.207 1.6
Pain agnosia 104 3.037 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 1.0e-02

PDB (46)

Gene RIF (11)

AA Sequence

MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPF      1 - 70
RPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRD     71 - 140
FPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFR    141 - 210
LDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTV    211 - 280
IRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF    281 - 350
TRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQP    351 - 420
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKA    421 - 490
HFSISNSAEDPFIAIHAESKL                                                     491 - 511
//

Text Mined References (46)

PMID Year Title