Property Summary

NCBI Gene PubMed Count 3
PubMed Score 5.83
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.700 5.3e-06
astrocytic glioma -1.800 3.1e-03
Astrocytoma, Pilocytic -1.300 2.8e-06
atypical teratoid / rhabdoid tumor -2.000 6.2e-10
ependymoma -2.400 5.3e-03
glioblastoma -1.700 2.1e-09
lung carcinoma 1.300 3.5e-20
medulloblastoma -1.300 1.7e-04
medulloblastoma, large-cell -2.000 3.0e-05
oligodendroglioma -1.700 8.9e-03
osteosarcoma -1.144 2.4e-03
Pick disease -1.300 9.3e-05
primitive neuroectodermal tumor -1.400 7.5e-04
subependymal giant cell astrocytoma -2.009 4.0e-02

 Compartment GO Term (2)

AA Sequence

MPRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEILHPEVQTLDLRS      1 - 70
CDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNC     71 - 140
QLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDG    141 - 210
AVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY                          211 - 258
//

Text Mined References (5)

PMID Year Title