Property Summary

NCBI Gene PubMed Count 21
PubMed Score 18.06
PubTator Score 10.92

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (8)

AA Sequence

MGVLGRVLLWLQLCALTQAVSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDML      1 - 70
LPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHD     71 - 140
DVFFPPSASFRVGLGPGASPVRVRSISALGRTFTRDEDLAVFLASRAGRLRFHGPGALSVGPEDCADPSG    141 - 210
CVCGNAEAQPWICAALLQPLGGRCPQAACHSALRPQGQCCDLCGAVVLLTHGPAFDLERYRARILDTFLG    211 - 280
LPQYHGLQVAVSKVPRSSRLREADTEIQVVLVENGPETGGAGRLARALLADVAENGEALGVLEATMRESG    281 - 350
AHVWGSSAAGLAGGVAAAVLLALLVLLVAPPLLRRAGRLRWRRHEAAAPAGAPLGFRNPVFDVTASEELP    351 - 420
LPRRLSLVPKAAADSTSHSYFVNPLFAGAEAEA                                         421 - 453
//

Text Mined References (23)

PMID Year Title