Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.78
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
psoriasis 1.800 5.2e-07
osteosarcoma -2.779 6.3e-06
glioblastoma 1.100 1.6e-04
medulloblastoma, large-cell 1.500 1.0e-05
tuberculosis and treatment for 6 months 1.100 6.3e-06
non-small cell lung cancer 1.641 2.7e-15
intraductal papillary-mucinous adenoma (... 1.700 6.9e-03
intraductal papillary-mucinous carcinoma... 2.000 5.9e-03
intraductal papillary-mucinous neoplasm ... 2.600 1.1e-02
lung cancer -1.500 3.1e-04
active Crohn's disease 1.090 1.2e-02
Breast cancer 3.200 2.3e-02
cystic fibrosis -1.100 2.2e-04
pediatric high grade glioma 1.300 6.1e-06
posterior fossa group A ependymoma 1.200 3.5e-06
spina bifida -2.151 3.0e-02
gastric carcinoma 1.200 4.7e-02
ductal carcinoma in situ 1.500 3.0e-04
invasive ductal carcinoma 1.200 5.0e-02
ovarian cancer -2.400 8.4e-07

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
19460752 Knockdown of Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 (AMMECR1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
15558565 PH0010 from Pyrococcus horikoshii is highly homologous to human AMMECR 1C-terminal region

AA Sequence

MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTL      1 - 70
SPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYC     71 - 140
HLYGYQQPRTPRFTNEPYPLFVTWKIGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRFPPMTRDEL    141 - 210
PRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGY    211 - 280
KAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS                     281 - 333
//

Text Mined References (14)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
24646681 2014 A highly conserved family of domains related to the DNA-glycosylase fold helps predict multiple novel pathways for RNA modifications.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21304492 2011 Amer1/WTX couples Wnt-induced formation of PtdIns(4,5)P2 to LRP6 phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15558565 2005 Crystal structure of PH0010 from Pyrococcus horikoshii, which is highly homologous to human AMMECR 1C-terminal region.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10049589 1999 Identification and characterization of a highly conserved protein absent in the Alport syndrome (A), mental retardation (M), midface hypoplasia (M), and elliptocytosis (E) contiguous gene deletion syndrome (AMME).
9480748 1998 FACL4, a new gene encoding long-chain acyl-CoA synthetase 4, is deleted in a family with Alport syndrome, elliptocytosis, and mental retardation.