Property Summary

NCBI Gene PubMed Count 11
PubMed Score 113.91
PubTator Score 7.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
aldosterone-producing adenoma -1.379 4.5e-02
astrocytic glioma -1.800 9.9e-03
Breast cancer 1.800 4.5e-02
breast carcinoma -1.900 1.5e-20
cutaneous lupus erythematosus 1.100 4.6e-03
cystic fibrosis 2.200 1.0e-03
ependymoma 1.700 2.9e-03
gastric carcinoma 2.300 3.2e-02
group 4 medulloblastoma -1.800 2.6e-03
head and neck cancer -1.400 9.2e-04
interstitial cystitis -1.100 2.8e-03
intraductal papillary-mucinous adenoma (... -1.600 4.7e-02
invasive ductal carcinoma 1.671 9.0e-03
lung carcinoma 2.400 3.4e-28
malignant mesothelioma 1.400 3.0e-06
medulloblastoma, large-cell -2.300 1.6e-04
ovarian cancer -3.600 4.6e-06
pancreatic cancer 1.700 7.5e-06
pituitary cancer 2.800 1.3e-05
primary pancreatic ductal adenocarcinoma 2.058 3.6e-02
psoriasis 1.800 7.0e-04
ulcerative colitis 1.100 1.6e-02

Gene RIF (4)

AA Sequence

MSLRVHTLPTLLGAVVRPGCRELLCLLMITVTVGPGASGVCPTACICATDIVSCTNKNLSKVPGNLFRLI      1 - 70
KRLDLSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDLSSNKLKTVKNAVFQEL     71 - 140
KVLEVLLLYNNHISYLDPSAFGGLSQLQKLYLSGNFLTQFPMDLYVGRFKLAELMFLDVSYNRIPSMPMH    141 - 210
HINLVPGKQLRGIYLHGNPFVCDCSLYSLLVFWYRRHFSSVMDFKNDYTCRLWSDSRHSRQVLLLQDSFM    211 - 280
NCSDSIINGSFRALGFIHEAQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVI    281 - 350
ESPRFEDAGVYSCIAMNKQRLLNETVDVTINVSNFTVSRSHAHEAFNTAFTTLAACVASIVLVLLYLYLT    351 - 420
PCPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEA    421 - 490
VIAEGILKSTRGKSDSDSVNSVFSDTPFVAST                                          491 - 522
//

Text Mined References (13)

PMID Year Title