Property Summary

NCBI Gene PubMed Count 9
PubMed Score 52.37
PubTator Score 31.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.800 1.5e-07
astrocytic glioma -1.700 1.8e-03
Astrocytoma, Pilocytic -1.900 3.1e-10
atypical teratoid / rhabdoid tumor -2.200 1.0e-10
ependymoma -1.900 3.1e-03
glioblastoma -1.700 5.6e-10
intraductal papillary-mucinous carcinoma... -1.200 3.8e-04
intraductal papillary-mucinous neoplasm ... -1.400 1.7e-03
medulloblastoma -1.300 1.3e-06
medulloblastoma, large-cell -2.000 1.3e-06
oligodendroglioma -1.500 6.2e-03
osteosarcoma -1.802 1.0e-03
pituitary cancer 1.400 2.8e-05
primitive neuroectodermal tumor -1.800 9.7e-06
sarcoidosis -1.100 2.5e-06
subependymal giant cell astrocytoma -1.185 3.4e-02

Gene RIF (1)

AA Sequence

MHPHRDPRGLWLLLPSLSLLLFEVARAGRAVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSH      1 - 70
NNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSNQLRTLDEFLFSDLQVLEVLL     71 - 140
LYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPA    141 - 210
WIKNGLYLHNNPLNCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEA    211 - 280
HLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNE    281 - 350
TLSVELKVHNFTLHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLS    351 - 420
TTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTP    421 - 490
IVV                                                                       491 - 493
//

Text Mined References (11)

PMID Year Title