Property Summary

NCBI Gene PubMed Count 62
PubMed Score 283.82
PubTator Score 112.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 2.624 1.2e-05
atypical teratoid / rhabdoid tumor -1.300 3.8e-03
medulloblastoma -1.400 2.4e-02
medulloblastoma, large-cell -2.500 1.5e-03
Multiple Sclerosis 1.400 9.4e-04
cystic fibrosis -1.300 1.8e-05
severe Alzheimer's disease -1.187 4.0e-02
spina bifida -1.136 2.9e-02
Pick disease -1.100 4.6e-02
pituitary cancer 1.600 3.5e-02

Gene RIF (43)

PMID Text
26424800 Authors conclude that the Hrd1 complex forms an essential retrotranslocation module that is evolutionarily conserved, but the mammalian ERAD system uses additional ubiquitin ligases to assist Hrd1 during retrotranslocation.
26136223 Downregulation of AMFR induced cell cycle arrest at the G0/G1 phase, and increased apoptosis of the THP1 cells.
25409783 gp78 elongates polyubiquitin chains from the distal end through the cooperation of its G2BR and CUE domains.
25149074 Data show that autocrine motility factor receptor (AMFR) and NOTCH1 protein are the direct target genes of microRNA miR-139-5p in colorectal cancer (CRC).
24820123 DGAT2 is regulated by gp78-associated endoplasmic-reticulum-associated degradation at the post-translational level.
24810856 Our data uncovers a previously unknown functional link between gp78 and TRIM25 and provides mechanistic insight into gp78-mediated protein ubiquitylation.
24714645 The ubiquitin ligase gp78, known for its role in protein quality control, is critical for unglycosylated PrP ubiquitylation and degradation.
24568530 High AMFR expression is associated with invasion depth and lymph node metastasis in gastric cancer.
24424410 The authors identify USP13 as a gp78-associated deubiquitinase that eliminates ubiquitin conjugates from Ubl4A to maintain the functionality of Bag6.
24285545 data thus implicate two parallel pathways by which Gp78 regulates MAVS signaling
23942235 gp78 is a ubiquitination machine where multiple E2-binding sites coordinately facilitate processive ubiquitination.
23666464 gp78 is expressed specifically in human prostate cancer rather than normal prostate tissues, it could be a putative biomarker for prostate cancer diagnosis.
23427266 A novel role for the endoplasmic reticulum-associated Gp78 ubiquitin ligase and the Mfn1 mitochondrial fusion factor in mitophagy.
23123110 The GP78 CUE domain functions to both facilitate substrate binding and enable switching between adjacent ubiquitin molecules of a growing chain to enable processivity in ubiquitination.
22812524 This review summarizes the structure and function of GP78, and its importance in both physiological and pathological processes.[review]
22328510 Delivery of ubiquitylated substrate to the central ER was regulated by ubiquitin chain elongation and opposing actions of gp78 CUE domain interactions and p97 recruitment.
21343306 identify two ER membrane proteins, SPFH2 and TMUB1, as associated proteins of gp78, a membrane-bound ubiquitin ligase that mediates sterol-accelerated ERAD of the cholesterol biosynthetic enzyme HMG-CoA reductase.
20574759 cell surface expression of AMFR is associated with progression in Chronic lymphocytic leukemia
20504226 AMFR pathway promotes invasion of esophageal squamous cell cancer cells
20089858 KAI1 has a role in promotion of cell proliferation and mammary gland hyperplasia by the gp78 ubiquitin ligase
19864457 These data demonstrate a role of the E3 ubiquitin ligases in CTA1 retro-translocation.
19835843 Hrd1 targets gp78 for proteasomal degradation independent of the ubiquitin ligase activity of gp78, without evidence of a reciprocal effect.
19828134 The results support that gp78 is an E3 targeting CFTRDeltaF508 for degradation and Hrd1 inhibits CFTRDeltaF508 degradation by acting as an E3 for gp78.
19661182 Gp78 promotes SOD1 and ataxin-3 degradation in endoplasmic reticulum.
19560420 The G2BR domain within the E3 gp78 binds selectively and with high affinity to the E2 Ube2g2.
19103148 both UBC7/gp78 and UbcH5a/CHIP may be involved in CYP3A4 ER-associated degradation, although their relative physiological contribution remains to be established
18037895 gp78 promotes sarcoma metastasis by targeting KAI1 for degradation
17872946 SVIP is an endogenous inhibitor of ERAD that acts through regulating the assembly of the gp78-p97/VCP-Derlin1 complex.
17681147 This study identifies Ufd1 as a cofactor of gp78, reveals an unappreciated function of Ufd1 in the ubiquitination reaction during endoplasmic reticulum -associated degradation, and illustrates that Ufd1 plays a critical role in cholesterol metabolism.
17310145 Ube2g2/gp78-mediated polyubiquitination involves preassembly of Lys 48-linked ubiquitin chains at the catalytic cysteine of Ube2g2
17265125 Findings suggest a strong correlation between the expression of AMFR and RhoC and a correlation between them and invasion and metastasis of hepatocellular carcinoma.
17071500 the receptor molecule for AMF/NLK/MF in leukemic differentiation is not gp78
17043353 Insig-1 sterol-regulated degradation is mediated by the membrane-bound ubiquitin ligase gp78
16979136 These data indicate that gp78 assumes multiple unique quality control roles over ATZ, including the facilitation of degradation and inhibition of aggregation of ATZ.
16563432 N-glyco side-chain of AMFR is a trigger and that interaction between the 117-C-terminal part of AMF and the extracellular core protein of AMFR is needed during AMF-AMFR interactions
16407162 gp78-mediated ubiquitylation is an early step in endoplasmic reticulum -associated degradation
16184720 AMFR expression predicts an unfavourable surgical outcome in patients with stage I pulmonary adenocarcinomas
16168377 Results identify gp78 as the E3 that initiates sterol-accelerated degradation of reductase, and Insig-1 as a bridge between gp78/VCP and the reductase substrate.
15303277 data provide evidence that the AMFR sequence coding for a seven-transmembrane domain E3 ubiquitin ligase codes for the gp78/AMFR protein recognized by the 3F3A mAb; the 3F3A mAb selectively recognizes a subpopulation of AMFR localized to an ER subdomain
12962414 Autocrine motility factor receptor may contribute to tumor progression and AMF-R gene expression can serve as a useful prognostic marker in non-small cell lung cancers (NSCLC).
12670940 demonstrate that GP78 is a bona fide E3 ligase in the apoB ER-associated degradation pathway
12067203 In a prospective study we have also analyzed AMF receptor protein expression in primary tumors of 54 skin melanoma patients using IHC
11902125 hippocampal expression of NLK and its receptor gp78 is associated with maze learning in rats.

AA Sequence

MPLLFLERFPWPSLRTYTGLSGLALLGTIISAYRALSQPEAGPGEPDQLTASLQPEPPAPARPSAGGPRA      1 - 70
RDVAQYLLSDSLFVWVLVNTACCVLMLVAKLIQCIVFGPLRVSERQHLKDKFWNFIFYKFIFIFGVLNVQ     71 - 140
TVEEVVMWCLWFAGLVFLHLMVQLCKDRFEYLSFSPTTPMSSHGRVLSLLVAMLLSCCGLAAVCSITGYT    141 - 210
HGMHTLAFMAAESLLVTVRTAHVILRYVIHLWDLNHEGTWEGKGTYVYYTDFVMELTLLSLDLMHHIHML    211 - 280
LFGNIWLSMASLVIFMQLRYLFHEVQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQA    281 - 350
ARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIADNNRVREEHQGENLDENLVPVAAAEGRPRLNQHNH    351 - 420
FFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITT    421 - 490
DNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLDLSPRLEETLDFGEVEVEPSE    491 - 560
VEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNKSSEDDAASESFLPSEGASSDPVTLRRRMLA    561 - 630
AAAERRLQKQQTS                                                             631 - 643
//

Text Mined References (67)

PMID Year Title
26424800 2015 gp78 functions downstream of Hrd1 to promote degradation of misfolded proteins of the endoplasmic reticulum.
26136223 2015 Autocrine motility factor receptor promotes the proliferation of human acute monocytic leukemia THP-1 cells.
25409783 2014 gp78 elongates of polyubiquitin chains from the distal end through the cooperation of its G2BR and CUE domains.
25149074 2014 MiR-139-5p inhibits migration and invasion of colorectal cancer by downregulating AMFR and NOTCH1.
24820123 2014 Regulation of diacylglycerol acyltransferase 2 protein stability by gp78-associated endoplasmic-reticulum-associated degradation.
24810856 2014 Polyubiquitylation of AMF requires cooperation between the gp78 and TRIM25 ubiquitin ligases.
24714645 2014 Ubiquitin ligase gp78 targets unglycosylated prion protein PrP for ubiquitylation and degradation.
24568530 2014 Aberrant expression of the autocrine motility factor receptor correlates with poor prognosis and promotes metastasis in gastric carcinoma.
24424410 2014 USP13 antagonizes gp78 to maintain functionality of a chaperone in ER-associated degradation.
24285545 2014 Regulation of mitochondrial antiviral signaling (MAVS) expression and signaling by the mitochondria-associated endoplasmic reticulum membrane (MAM) protein Gp78.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23942235 2013 Allosteric regulation of E2:E3 interactions promote a processive ubiquitination machine.
23666464 2013 gp78 is specifically expressed in human prostate cancer rather than normal prostate tissue.
23427266 2013 Regulation of mitophagy by the Gp78 E3 ubiquitin ligase.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23246001 2012 SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23123110 2012 Promiscuous interactions of gp78 E3 ligase CUE domain with polyubiquitin chains.
22812524 2012 gp78: a multifaceted ubiquitin ligase that integrates a unique protein degradation pathway from the endoplasmic reticulum.
22328510 2012 Peripheral endoplasmic reticulum localization of the Gp78 ubiquitin ligase activity.
21914798 2011 The structural and functional basis of the p97/valosin-containing protein (VCP)-interacting motif (VIM): mutually exclusive binding of cofactors to the N-terminal domain of p97.
21636303 2011 A ubiquitin ligase-associated chaperone holdase maintains polypeptides in soluble states for proteasome degradation.
21343306 2011 Membrane-associated ubiquitin ligase complex containing gp78 mediates sterol-accelerated degradation of 3-hydroxy-3-methylglutaryl-coenzyme A reductase.
20574759 2011 The autocrine motility factor receptor is overexpressed on the surface of B cells in Binet C chronic lymphocytic leukemia.
20504226 2010 Autocrine motility factor receptor signaling pathway promotes cell invasion via activation of ROCK-2 in esophageal squamous cell cancer cells.
20089858 2010 A role for KAI1 in promotion of cell proliferation and mammary gland hyperplasia by the gp78 ubiquitin ligase.
19946888 2010 Defining the membrane proteome of NK cells.
19864457 2010 The E3 ubiquitin ligases Hrd1 and gp78 bind to and promote cholera toxin retro-translocation.
19835843 2009 Targeting of gp78 for ubiquitin-mediated proteasomal degradation by Hrd1: cross-talk between E3s in the endoplasmic reticulum.
19828134 2010 Differential regulation of CFTRDeltaF508 degradation by ubiquitin ligases gp78 and Hrd1.
19661182 2009 Gp78, an ER associated E3, promotes SOD1 and ataxin-3 degradation.
19560420 2009 Allosteric activation of E2-RING finger-mediated ubiquitylation by a structurally defined specific E2-binding region of gp78.
19103148 2009 CYP3A4 ubiquitination by gp78 (the tumor autocrine motility factor receptor, AMFR) and CHIP E3 ligases.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18037895 2007 The ubiquitin ligase gp78 promotes sarcoma metastasis by targeting KAI1 for degradation.
17872946 2007 Identification of SVIP as an endogenous inhibitor of endoplasmic reticulum-associated degradation.
17681147 2007 Ufd1 is a cofactor of gp78 and plays a key role in cholesterol metabolism by regulating the stability of HMG-CoA reductase.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17310145 2007 A ubiquitin ligase transfers preformed polyubiquitin chains from a conjugating enzyme to a substrate.
17265125 2007 Elevated expression of autocrine motility factor receptor correlates with overexpression of RhoC and indicates poor prognosis in hepatocellular carcinoma.
17157811 2007 ER stress differentially regulates the stabilities of ERAD ubiquitin ligases and their substrates.
17071500 2006 AMF/G6PI induces differentiation of leukemic cells via an unknown receptor that differs from gp78.
17043353 2006 Sterol-regulated degradation of Insig-1 mediated by the membrane-bound ubiquitin ligase gp78.
16979136 2006 Ubiquitin ligase gp78 increases solubility and facilitates degradation of the Z variant of alpha-1-antitrypsin.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16563432 2006 The autocrine motility factor (AMF) and AMF-receptor combination needs sugar chain recognition ability and interaction using the C-terminal region of AMF.
16407162 2006 The activity of a human endoplasmic reticulum-associated degradation E3, gp78, requires its Cue domain, RING finger, and an E2-binding site.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16275660 2006 Identification of VCP/p97, carboxyl terminus of Hsp70-interacting protein (CHIP), and amphiphysin II interaction partners using membrane-based human proteome arrays.
16186510 2005 Recruitment of the p97 ATPase and ubiquitin ligases to the site of retrotranslocation at the endoplasmic reticulum membrane.
16184720 2005 Autocrine motility factor receptor expression implies an unfavourable prognosis in resected stage I pulmonary adenocarcinomas.
16168377 2005 Gp78, a membrane-anchored ubiquitin ligase, associates with Insig-1 and couples sterol-regulated ubiquitination to degradation of HMG CoA reductase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331598 2004 AAA ATPase p97/valosin-containing protein interacts with gp78, a ubiquitin ligase for endoplasmic reticulum-associated degradation.
15303277 2004 The gene product of the gp78/AMFR ubiquitin E3 ligase cDNA is selectively recognized by the 3F3A antibody within a subdomain of the endoplasmic reticulum.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12962414 2003 Autocrine motility factor-receptor gene expression in lung cancer.
12847084 2003 Function of the p97-Ufd1-Npl4 complex in retrotranslocation from the ER to the cytosol: dual recognition of nonubiquitinated polypeptide segments and polyubiquitin chains.
12670940 2003 Overexpression of the tumor autocrine motility factor receptor Gp78, a ubiquitin protein ligase, results in increased ubiquitinylation and decreased secretion of apolipoprotein B100 in HepG2 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11902125 2002 A link between maze learning and hippocampal expression of neuroleukin and its receptor gp78.
11724934 2001 The tumor autocrine motility factor receptor, gp78, is a ubiquitin protein ligase implicated in degradation from the endoplasmic reticulum.
10456327 1999 The autocrine motility factor receptor gene encodes a novel type of seven transmembrane protein.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
7626106 1995 Identification of an upstream region that controls the transcription of the human autocrine motility factor receptor.
1649192 1991 Purification of human tumor cell autocrine motility factor and molecular cloning of its receptor.