Property Summary

NCBI Gene PubMed Count 72
PubMed Score 292.79
PubTator Score 112.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 3.8e-03
cystic fibrosis -1.200 1.0e-04
medulloblastoma -1.400 2.4e-02
medulloblastoma, large-cell -2.500 1.5e-03
Multiple Sclerosis 1.400 9.4e-04
osteosarcoma 2.624 1.2e-05
Pick disease -1.100 4.6e-02
pituitary cancer 1.600 3.5e-02
severe Alzheimer's disease -1.187 4.0e-02
spina bifida -1.136 2.9e-02

PDB (12)

Gene RIF (49)

AA Sequence

MPLLFLERFPWPSLRTYTGLSGLALLGTIISAYRALSQPEAGPGEPDQLTASLQPEPPAPARPSAGGPRA      1 - 70
RDVAQYLLSDSLFVWVLVNTACCVLMLVAKLIQCIVFGPLRVSERQHLKDKFWNFIFYKFIFIFGVLNVQ     71 - 140
TVEEVVMWCLWFAGLVFLHLMVQLCKDRFEYLSFSPTTPMSSHGRVLSLLVAMLLSCCGLAAVCSITGYT    141 - 210
HGMHTLAFMAAESLLVTVRTAHVILRYVIHLWDLNHEGTWEGKGTYVYYTDFVMELTLLSLDLMHHIHML    211 - 280
LFGNIWLSMASLVIFMQLRYLFHEVQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQA    281 - 350
ARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIADNNRVREEHQGENLDENLVPVAAAEGRPRLNQHNH    351 - 420
FFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITT    421 - 490
DNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLDLSPRLEETLDFGEVEVEPSE    491 - 560
VEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNKSSEDDAASESFLPSEGASSDPVTLRRRMLA    561 - 630
AAAERRLQKQQTS                                                             631 - 643
//

Text Mined References (77)

PMID Year Title