Property Summary

NCBI Gene PubMed Count 30
PubMed Score 37.60
PubTator Score 27.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 3.0e-07
ovarian cancer 8491 6.0e-05

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.470 3.0e-07
ovarian cancer 1.700 6.0e-05

Protein-protein Interaction (3)

Gene RIF (15)

PMID Text
26763392 Ambra1 is a crucial regulator of autophagy and apoptosis in ovarian cancer cells subject to cisplatin to maintain the balance between autophagy and apoptosis. Ambra1-targeting inhibition might sensitize ovarian cancer cells to chemotherapy.
26423274 An increased expression of AMBRA1 and SQSTM1.
26086269 Ambra1 mRNA translocation to P-bodies and translational suppression correlated with increased cell death.
25803737 Both AMBRA1 and BECLIN 1 affect c-Myc regulation, but through two different pathways.
25499913 AMBRA1 interacts with cullin E3 ubiquitin ligases to regulate autophagy dynamics
25438055 a de-regulation of c-Myc correlates with increased tumorigenesis in AMBRA1-defective systems, thus supporting a role for AMBRA1 as a haploinsufficient tumour suppressor gene.
24587252 Ambra1 is a crucial regulator of autophagy and apoptosis in colorectal cancer cells
23551272 A schizophrenia-related risk variant in AMBRA1 (rs11819869) is involved in various aspects of impulsivity, and this involvement occurs on a behavioral as well as an imaging genetics level.
23524951 findings show under non-autophagic conditions, mTOR inhibits AMBRA1 by phosphorylation, whereas on autophagy induction, AMBRA1 is dephosphorylated; in this condition, AMBRA1, interacting with TRAF6, supports ULK1 ubiquitylation by LYS-63-linked chains, and its stabilization, self-association and function
23429496 Data suggest that activated autophagy is associated with the progression of pancreatic ductal adenocarcinoma and that the overexpression of autophagy-related proteins Atg5, Ambra1, beclin-1, LC3B and Bif-1 is significantly correlated with poor outcome.
23069654 role that Ambra1 in the switch between autophagy and apoptosis
22441670 Ambra1 is an important target of apoptotic proteases resulting in the dismantling of the autophagic machinery and the accomplishment of the cell death program
22190034 HIV-1 Vif is identified to have a physical interaction with autophagy/beclin-1 regulator 1 (AMBRA1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21358617 In this study, the authors show that AMBRA1 binds preferentially the mitochondrial pool of the antiapoptotic factor BCL-2, and that this interaction is disrupted following autophagy induction.
20921139 When autophagy is induced, ULK1 phosphorylates AMBRA1, releasing the autophagy core complex from dynein.

AA Sequence

MKVVPEKNAVRILWGRERGARAMGAQRLLQELVEDKTRWMKWEGKRVELPDSPRSTFLLAFSPDRTLLAS      1 - 70
THVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEVRIWDLHGGSESWFTDSNNAI     71 - 140
ASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEMERVRLVRFDPLGHYLLTAIVNPSNQQGDDE    141 - 210
PEIPIDGTELSHYRQRALLQSQPVRRTPLLHNFLHMLSSRSSGIQVGEQSTVQDSATPSPPPPPPQPSTE    211 - 280
RPRTSAYIRLRQRVSYPTAECCQHLGILCLCSRCSGTRVPSLLPHQDSVPPASARATTPSFSFVQTEPFH    281 - 350
PPEQASSTQQDQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHREIAPGLTGSEWT    351 - 420
RTVLSLNSRSEAESMPPPRTSASSVSLLSVLRQQEGGSQASVYTSATEGRGFPASGLATESDGGNGSSQN    421 - 490
NSGSIRHELQCDLRRFFLEYDRLQELDQSLSGEAPQTQQAQEMLNNNIESERPGPSHQPTPHSSENNSNL    491 - 560
SRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSSWQVPSSFESVPSSGSQLPPLERTEGQTPSSS    561 - 630
RLELSSSASPQEERTVGVAFNQETGHWERIYTQSSRSGTVSQEALHQDMPEESSEEDSLRRRLLESSLIS    631 - 700
LSRYDGAGSREHPIYPDPARLSPAAYYAQRMIQYLSRRDSIRQRSMRYQQNRLRSSTSSSSSDNQGPSVE    701 - 770
GTDLEFEDFEDNGDRSRHRAPRNARMSAPSLGRFVPRRFLLPEYLPYAGIFHERGQPGLATHSSVNRVLA    771 - 840
GAVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNASVNVLVQNCKIYNDASCDISADGQLLAAFIPS    841 - 910
SQRGFPDEGILAVYSLAPHNLGEMLYTKRFGPNAISVSLSPMGRYVMVGLASRRILLHPSTEHMVAQVFR    911 - 980
LQQAHGGETSMRRVFNVLYPMPADQRRHVSINSARWLPEPGLGLAYGTNKGDLVICRPEALNSGVEYYWD    981 - 1050
QLNETVFTVHSNSRSSERPGTSRATWRTDRDMGLMNAIGLQPRNPATSVTSQGTQTLALQLQNAETQTER   1051 - 1120
EVPEPGTAASGPGEGEGSEYGASGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHR   1121 - 1190
SSQTGTEPGAAHTSSPQPSTSRGLLPEAGQLAERGLSPRTASWDQPGTPGREPTQPTLPSSSPVPIPVSL   1191 - 1260
PSAEGPTLHCELTNNNHLLDGGSSRGDAAGPRGEPRNR                                   1261 - 1298
//

Text Mined References (40)

PMID Year Title
26763392 2016 shRNA-mediated AMBRA1 knockdown reduces the cisplatin-induced autophagy and sensitizes ovarian cancer cells to cisplatin.
26423274 2015 AMBRA1 and SQSTM1 expression pattern in prostate cancer.
26086269 2015 Prolonged Pseudohypoxia Targets Ambra1 mRNA to P-Bodies for Translational Repression.
25803737 2015 AMBRA1 and BECLIN 1 interplay in the crosstalk between autophagy and cell proliferation.
25499913 2014 AMBRA1 interplay with cullin E3 ubiquitin ligases regulates autophagy dynamics.
25438055 2015 AMBRA1 links autophagy to cell proliferation and tumorigenesis by promoting c-Myc dephosphorylation and degradation.
25215947 2015 AMBRA1 is able to induce mitophagy via LC3 binding, regardless of PARKIN and p62/SQSTM1.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24587252 2014 Ambra1 is an essential regulator of autophagy and apoptosis in SW620 cells: pro-survival role of Ambra1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23974797 2013 WASH inhibits autophagy through suppression of Beclin 1 ubiquitination.
23954414 2013 Beclin 2 functions in autophagy, degradation of G protein-coupled receptors, and metabolism.
23551272 2013 From gene to brain to behavior: schizophrenia-associated variation in AMBRA1 alters impulsivity-related traits.
23524951 2013 mTOR inhibits autophagy by controlling ULK1 ubiquitylation, self-association and function through AMBRA1 and TRAF6.
23429496 2013 Prognostic significance of autophagy-related protein expression in resected pancreatic ductal adenocarcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23069654 2013 Ambra1 at the crossroad between autophagy and cell death.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22441670 2012 Proteolysis of Ambra1 during apoptosis has a role in the inhibition of the autophagic pro-survival response.
22190034 2011 Global landscape of HIV-human protein complexes.
21753002 2011 Parkin interacts with Ambra1 to induce mitophagy.
21358617 2011 Mitochondrial BCL-2 inhibits AMBRA1-induced autophagy.
20921139 2010 The dynamic interaction of AMBRA1 with the dynein motor complex regulates mammalian autophagy.
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
20562859 2010 Network organization of the human autophagy system.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17622796 A novel role for autophagy in neurodevelopment.
17603510 2007 Autophagy: a new regulator of development.
17589504 2007 Ambra1 regulates autophagy and development of the nervous system.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11214970 2000 Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.