Property Summary

NCBI Gene PubMed Count 100
PubMed Score 296.08
PubTator Score 308.15

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

Gene RIF (88)

PMID Text
26928323 AMACR transcripts were detected in all radical prostatectomy(RP)-prostate cancer and RP-Benign samples but not in non-cancerous cystoprostatectomy samples, which suggest a global increase of AMACR expression in cancerous prostates.
26648339 AMACRwas not regulated in the white blood cells of multiple sclerosis patients
25773837 The D175G and M9V polymorphisms of the AMACR gene are related to prostate cancer. The S201L polymorphism might be linked with prostate cancer risk. no association was observed between K277E or Q239H polymorphisms and susceptibility to prostate cancer.
25551297 In diagnosis of ovarian clear cell carcinoma, AMACR is highly specific but suboptimally sensitive.
25473890 AMACR amplification is a mechanism driving increased mRNA and protein expression and conferring aggressiveness through heightened cell proliferation in gastrointestinal stromal tumors
25384383 Overexpressed AMACR in myxofibrosarcomas can be amplification-driven, associated with tumor aggressiveness, and may be relevant as a druggable target.
25313761 Combination of p63 and AMACR is of great additional value in combating the morphologically suspicious cases and should be used on case to case basis especially in prostatic needle biopsies and small foci lesions.
25307752 The overexpression of AMACR in prostate cancer was not associated with dietary influences on phytanic acid.
25149154 Our results suggest AMACR as an immunohistochemical marker for distinguishing malignant melanomas and dysplastic nevi from conventional melanocytic nevi.
25092674 AMACR might be a potential prognostic marker for predicting early recurrence/metastasis of hepatocellular carcinoma after hepatectomy.
24833092 AMACR overexpression was identified as an important prognosticator and a potential therapeutic target in the future
24705308 AMACR should be the first-line positive marker for confirmation of a diagnosis of minimal adenocarcinoma of the prostate.
24675392 AMACR is a useful immunohistochemical marker for the differential diagnosis of solid pseudopapillary neoplasms of the pancreas.
24383053 Genetic variations of AMACR are associated with the risk of sporadic prostate cancer that underwent radical prostatectomy in Koreans.
24119561 These findings indicate that AMACR expression is strongly associated with endometrial clear cell carcionma and displays a relatively robust diagnostic test performance.
24004067 Strong AMACR expression is associated with an increased risk of neoplastic progression in Barrett's esophagus.
23797726 ERG immunohistochemistry could be considered in a second round of immunostaining of select difficult cases of foamy gland carcinoma of the prostate with low AMACR expression.
23434146 Of the cases of clear cell renal carcinoma there was immunoreactivity for alpha-methylacyl-CoA racemase and strong diffuse immuno-positivity for cytokeratin.
23376124 role of AMACR in drug metabolism, cancer and drug design
23235347 Overall disease-free survival tended to be worse in AMACR-positive patients, and in adenocarcinoma subgroup, it was significantly shorter
22782380 Our results indicate that alpha-methylacyl-coenzyme A racemase is a useful marker for distinguishing between grade 1 and grade 2 neuroendocrine tumours, and neuroendocrine carcinoma of the stomach
22593005 The sensitivity and specificity of AMACR for the diagnosis of prostate adenocarcinoma and benign glands in Japanese patients are lower than those previously reported in Western countries.
22542076 Alpha methylacyl-COA racemase cannot discriminate hepatocellular carcinoma from liver cell dysplasiA, although it can separate both of them from nondysplastic lesions.
22507319 AMACR can be considered a more accurate marker than PTOV1 in the identification of high-grade prostatic intraepithelial neoplasia (HGPIN) and of prostate cancer.
22248277 High AMACR is associated with prostate cancer.
22078291 Alpha-methylacyl-coenzyme A racemase expression is associated with mucin phenotypes of gastric neoplasia, particularly with the expression of CDX2 and MUC5AC.
22009118 in the subgroup of papillary renal cell carcinoma both a higher grade and a presence of distant metastases were associated with a lower percentage of alpha-methylacyl CoA racemase (AMACR)expressing tumors.
21457159 Overexpression of alpha-methylacyl-CoA racemase is associated with CTNNB1 mutations in hepatocellular carcinomas
21441411 This report shows the first high-throughput screen for the discovery of novel AMACR inhibitors, characterizes the first nonsubstrate-based inhibitors, and validates that AMACR is a viable chemotherapeutic target in vitro.
21195844 Our data suggest that AMACR variants have better power than total AMACR in discriminating between CaP and adjacent normal tissue. These findings may be useful for the development of future diagnostic assays
21176184 A combination of high molecular weight cytokeratin and alpha-methylacyl CoA racemase is of great value in combating the morphologically suspicious cases and significantly increasing the diagnostic accuracy in prostate cancer.
20945498 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20875727 The results suggest that AMACR may play a significant role in susceptibility to schizophrenia in male patients.
20821052 Case Report: AMACR homozygous mutation responsible for adult onset alpha-methyl-acyl-CoA racemase deficiency.
20664974 Examine P504S expressing circulating prostate cells as a marker for prostate cancer.
20636793 AMACR shows promise as a marker to indicate indefinite dysplasia in Barrett's oesophagus.
20503447 Results describe alpha-methylacyl CoA racemase (AMACR) expression in relation to various dysplasia phenotypes and clinicopathological parameters of sporadic colorectal adenomas.
20189848 study showed that 34betaE12 is the most appropriate negative marker to combine with alpha-methylacyl coenzyme A racemase as a positive marker for the diagnosis of prostate adenocarcinoma[34betaE12]
20189848 Our study showed that 34betaE12 is the most appropriate negative marker to combine with AMACR as a positive marker for the diagnosis of prostate adenocarcinoma.
20102405 marker of differential diagnosis of kidney cancer
19692168 Observational study of gene-disease association. (HuGE Navigator)
19638170 The expression of AMACR is increased in benign sebaceous glands and sebaceous hyperplasia; with decreasing AMACR expression in tumors with less sebaceous differentiation
19625176 Observational study of gene-disease association. (HuGE Navigator)
19605815 AMACR showed diffuse or focal positivity in cancer, high-grade prostatic intraepithelial neoplasia, and atypia
19459159 P504S/AMACR staining might be of great value in cytodiagnosis of prostate lesions
19384190 AMACR immunostaining does not seem to be a useful marker in distinguishing nephrogenic adenoma from prostatic adenocarcinoma
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19148275 deregulation of Alpha-methylacyl-coenzyme A racemase during colon carcinogenesis involves two nonrandom events, resulting in the mutually exclusive existence of double-deletion at CG3 and CG10 and deletion of CG12-16 in a newly identified CpG island
19068396 Immunohistochemistry with anti-AMACR/TO63 is useful for detecting prostate cancer in the full range of prostate specimens encountered in needle biopsies.
19064571 Observational study of gene-disease association. (HuGE Navigator)
18835622 combined alpha-methylacyl coenzyme A racemase/p53 analysis may represent a helpful tool to confirm dysplasia in inflammatory bowel disease.
18788852 The immunohistochemical profile of clear cell carcinomas of the urinary tract...is positive for P504S
18785113 The high level expression of AMACR in high-grade dysplasia and carcinoma suggests that it may be a useful biomarker in distinguishing high-grade dysplasia and carcinoma from low-grade dysplasia.
18712414 AMACR expression in colorectal cancer was significantly associated with tumor grade, stage, non-mucinous phenotype, and left-sided tumor localization. AMACR staining results were unrelated to clinical outcome.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18665038 Overexpression of alpha-methylacyl-CoA racemase ia a useful parameter for identifying dysplasia in Barrett esophagus.
18577240 Increased AMACR expression and its association with tumor venous invasion suggest that alpha-Methylacyl-CoA racemase may play a role in hepatocellular carcinoma development and progression.
18537123 In a relatively genetically homogenous Tasmanian population, there is evidence for a significant association between variants within the AMACR gene and prostate cancer risk.
18537123 Observational study of gene-disease association. (HuGE Navigator)
18500268 AMACR expression may be a new diagnostic marker for dysplasia carcinoma sequence in Barrett's low-grade neoplastic lesions.
18279392 Review about the role of AMACR in the branched-chain fatty amino acids metabolism and its link with cancer.
18080842 promoter function of AMACR is independent of androgen receptor-mediated signaling
18032455 Sequence analysis of AMACR cDNA identified a homozygous point mutation (c154T>C). This case adds to the phenotypic variation seen in this peroxisomal disorder.
17684125 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17684125 Variants in AMACR associated with advanced distal colorectal adenoma were identified and pointed to potential interactions with iburpofen use.
17683075 Observational study of gene-disease association. (HuGE Navigator)
17683075 Our results confirm an initial report of association between the AMACR gene and the risk of familial prostate cancer.
17680641 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17680641 AMACR gene variants were unrelated to prostate cancer overall in this study.
17525630 AMACR overexpression in colorectal carcinoma is correlated with tumor differentiation.
17222253 Expression in prostatic cancer shows a correlation with Gleason severity score.
17067752 Increase in AMACR expression is associated with prostate cancer
16681682 AMACR immunohistochemical staining has shown the ability to improve detection of small focal prostatic carcinoma that could be missed by conventional histological examination.
16506014 Moderate to strong P504S expression in high-grade prostatic intraepithelial neoplasia of biopsy specimens is indicative of an associated adenocarcinoma.
16491480 expression of PSGR and PSGR2 relative to AMACR in prostate cancer; AMACR was the most overexpressed, but in some cases expression of AMACR was not significantly elevated while PSGR and/or PSGR2 were substantially elevated
16424894 AMACR immunoreactivity may be useful in differentiating papillary renal cell carcinoma from metanephric adenoma.
15941951 AMACR expression is significantly associated with prostate cancer progression and suggests that not all surrogate end points may be optimal to define biomarkers of aggressive prostate cancer
15941950 AMACR protein is expressed in normal breast and its expression seems to increase in invasive carcinomas
15880524 Novel variant of AMACR identified; real time PCR demonstrates that this splice variant is expressed in tumor, normal prostate tissue, and PC3 cell lines
15330799 Results demonstrated the promising features of AMACR as a biomarker for prostate cancer in this large series and the potential to develop automated quantitative diagnostic tests.
15323145 AMACR (P504S) has been proven to be one of the few biomarkers that can help distinguish cancer from benign cells, with high sensitivity and specificity for prostate carcinoma
14612535 Data suggest that AMACR is essential for optimal growth of prostate cancer cells in vitro and that this enzyme has the potential to be a complementary target with androgen ablation in PCa treatment.
12810662 AMACR was overexpressed in prostate cancer. One AMACR probeset from an alternatively spliced exon had 88% identity to a 521-bp sequence spanning 4 exons of fumarate hydratase. The predicted sequence revealed a new GLGELIL peptide shared by both proteins.
12673556 expression in evolving carcinomas within benign prostatic hyperplasia and in cancers of the transition zone
12438241 Observational study of gene-disease association. (HuGE Navigator)
12213712 AMACR expression may be a marker of tumor differentiation
11926890 AMACR was shown to be overexpressed in prostate cancer

AA Sequence

MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLC      1 - 70
KRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGRSG     71 - 140
ENPYAPLNLLADFAGGGLMCALGIIMALFDRTRTGKGQVIDANMVEGTAYLSSFLWKTQKLSLWEAPRGQ    141 - 210
NMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAEKTK    211 - 280
AEWCQIFDGTDACVTPVLTFEEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHT    281 - 350
EEILEEFGFSREEIYQLNSDKIIESNKVKASL                                          351 - 382
//

Text Mined References (106)

PMID Year Title
26928323 2016 Global expression of AMACR transcripts predicts risk for prostate cancer - a systematic comparison of AMACR protein and mRNA expression in cancerous and noncancerous prostate.
26648339 2016 Alpha-methylacyl-CoA racemase deletion has mutually counteracting effects on T-cell responses, associated with unchanged course of EAE.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25773837 2015 Significant association of alpha-methylacyl-CoA racemase gene polymorphisms with susceptibility to prostate cancer: a meta-analysis.
25551297 2015 Comparative analysis of Napsin A, alpha-methylacyl-coenzyme A racemase (AMACR, P504S), and hepatocyte nuclear factor 1 beta as diagnostic markers of ovarian clear cell carcinoma: an immunohistochemical study of 279 ovarian tumours.
25473890 2014 AMACR amplification and overexpression in primary imatinib-naïve gastrointestinal stromal tumors: a driver of cell proliferation indicating adverse prognosis.
25384383 2014 AMACR amplification in myxofibrosarcomas: a mechanism of overexpression that promotes cell proliferation with therapeutic relevance.
25313761 Diagnostic utility of p63 and ?-methyl acyl Co A racemase in resolving suspicious foci in prostatic needle biopsy and transurethral resection of prostate specimens.
25307752 2015 Dietary influences on tissue concentrations of phytanic acid and AMACR expression in the benign human prostate.
25149154 2014 ?-Methylacyl-coenzyme A racemase (AMACR, p504s) is a marker to distinguish malignant melanomas from dysplastic nevi and melanocytic nevi.
25092674 2014 ?-Methylacyl-CoA racemase (AMACR) serves as a prognostic biomarker for the early recurrence/metastasis of HCC.
24833092 2014 AMACR overexpression as a poor prognostic factor in patients with nasopharyngeal carcinoma.
24705308 2014 Utility of ERG versus AMACR expression in diagnosis of minimal adenocarcinoma of the prostate in needle biopsy tissue.
24675392 2014 ?-Methylacyl-CoA racemase (P504S) is a useful marker for the differential diagnosis of solid pseudopapillary neoplasm of the pancreas.
24383053 2013 Genetic variations of ? -methylacyl-CoA racemase are associated with sporadic prostate cancer risk in ethnically homogenous Koreans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24119561 2013 Utility of ?-methylacyl-coenzyme-A racemase (p504s) immunohistochemistry in distinguishing endometrial clear cell carcinomas from serous and endometrioid carcinomas.
24004067 2013 Value of ?-methylacyl-CoA racemase immunochemistry for predicting neoplastic progression in Barrett's oesophagus.
23797726 2013 Foamy gland carcinoma of the prostate in needle biopsy: incidence, Gleason grade, and comparative ?-methylacyl-CoA racemase vs. ERG expression.
23434146 2013 Renal cell carcinoma with areas mimicking renal angiomyoadenomatous tumor/clear cell papillary renal cell carcinoma.
23376124 2013 ?-Methylacyl-CoA racemase (AMACR): metabolic enzyme, drug metabolizer and cancer marker P504S.
23235347 2013 ?-Methylacyl-CoA racemase (AMACR) in gastric cancer: correlation with clinicopathologic data and disease-free survival.
22782380 2012 Alpha-methylacyl-coenzyme A racemase expression in neuroendocrine neoplasms of the stomach.
22593005 2013 Alpha methylacyl-CoA racemase (AMACR) in prostate adenocarcinomas from Japanese patients: is AMACR a "race"-dependent marker?
22542076 2012 Role of alpha methylacyl-coenzyme A racemase in differentiating hepatocellular carcinoma from dysplastic and nondysplastic liver cell lesions.
22507319 Is there a role for prostate tumour overexpressed-1 in the diagnosis of HGPIN and of prostatic adenocarcinoma? A comparison with alpha-methylacyl CoA racemase.
22248277 2012 Evaluation of alpha-methylacyl-CoA racemase, metallothionein and prostate specific antigen as prostate cancer prognostic markers.
22078291 2012 Relationship between alpha-methylacyl-coenzyme A racemase expression and mucin phenotype in gastric cancer.
22009118 2013 Prognostic value of alpha-methyl CoA racemase (AMACR) expression in renal cell carcinoma.
21457159 2011 Overexpression of ?-methylacyl-CoA racemase is associated with CTNNB1 mutations in hepatocellular carcinomas.
21441411 2011 High-throughput screen identifies novel inhibitors of cancer biomarker ?-methylacyl coenzyme A racemase (AMACR/P504S).
21195844 2011 ?-Methylacyl-CoA racemase spliced variants and their expression in normal and malignant prostate tissues.
21176184 2010 Diagnostic utility of ?-methylacyl CoA racemase (P504S) & HMWCK in morphologically difficult prostate cancer.
20945498 2011 AMACR polymorphisms, dietary intake of red meat and dairy and prostate cancer risk.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20875727 2010 Non-synonymous variants in the AMACR gene are associated with schizophrenia.
20821052 2010 An adult onset case of alpha-methyl-acyl-CoA racemase deficiency.
20664974 2010 P504S expressing circulating prostate cells as a marker for prostate cancer.
20636793 2010 A study of indefinite for dysplasia in Barrett's oesophagus: reproducibility of diagnosis, clinical outcomes and predicting progression with AMACR (alpha-methylacyl-CoA-racemase).
20503447 2010 AMACR is associated with advanced pathologic risk factors in sporadic colorectal adenomas.
20189848 Reliability of the 34?E12, keratin 5/6, p63, bcl-2, and AMACR in the diagnosis of prostate carcinoma.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
20102405 2010 How useful is alpha-methylacyl-CoA racemase (AMACR) immunohistochemistry in the differential diagnosis of kidney cancers?
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19638170 2010 Expression of alpha-methylacyl-CoA racemase (P504S) in sebaceous neoplasms.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19605815 2009 Usefulness of cytokeratin 5/6 and AMACR applied as double sequential immunostains for diagnostic assessment of problematic prostate specimens.
19459159 2009 Alpha-methylacyl-CoA racemase (AMACR) in fine-needle aspiration specimens of prostate lesions.
19384190 2009 S-100A1 is a reliable marker in distinguishing nephrogenic adenoma from prostatic adenocarcinoma.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19148275 2009 Deletion hotspots in AMACR promoter CpG island are cis-regulatory elements controlling the gene expression in the colon.
19068396 2008 [Evaluation of p63 and p504s markers for the diagnosis of prostate cancer].
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18835622 2009 Combined alpha-methylacyl coenzyme A racemase/p53 analysis to identify dysplasia in inflammatory bowel disease.
18788852 2008 Clear cell adenocarcinoma of urinary bladder and urethra: another urinary tract lesion immunoreactive for P504S.
18785113 2008 a-Methylacyl coenzyme A racemase is highly expressed in the intestinal-type adenocarcinoma and high-grade dysplasia lesions of the stomach.
18712414 2008 AMACR expression in colorectal cancer is associated with left-sided tumor localization.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18665038 2008 p16, cyclin D1, Ki-67, and AMACR as markers for dysplasia in Barrett esophagus.
18577240 2008 Significance of overexpression of alpha methylacyl-coenzyme A racemase in hepatocellular carcinoma.
18537123 2008 Sequence variants of alpha-methylacyl-CoA racemase are associated with prostate cancer risk: a replication study in an ethnically homogeneous population.
18500268 2008 Expression of alpha-methylacyl coenzyme A racemase in the dysplasia carcinoma sequence associated with Barrett's esophagus.
18279392 2008 Alpha-methylacyl-CoA racemase--an 'obscure' metabolic enzyme takes centre stage.
18080842 2009 Molecular cloning and preliminary analysis of the human alpha-methylacyl-CoA racemase promoter.
18032455 2008 Relapsing encephalopathy in a patient with alpha-methylacyl-CoA racemase deficiency.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17684125 2007 Variants in the alpha-Methylacyl-CoA racemase gene and the association with advanced distal colorectal adenoma.
17683075 2007 Sequence variation in alpha-methylacyl-CoA racemase and risk of early-onset and familial prostate cancer.
17680641 2007 Polymorphic variants in alpha-methylacyl-CoA racemase and prostate cancer.
17525630 2007 Alpha-methylacyl-CoA racemase/P504S overexpression in colorectal carcinoma is correlated with tumor differentiation.
17222253 2007 Heterogeneous expression of alpha-methylacyl-CoA racemase in prostatic cancer correlates with Gleason score.
17067752 2006 Kinetic fluorescence reverse transcriptase-polymerase chain reaction for alpha-methylacyl CoA racemase distinguishes prostate cancer from benign lesions.
16756494 2006 Biochemistry of mammalian peroxisomes revisited.
16681682 2006 Detection of prostate cancer by alpha-methylacyl CoA racemase (P504S) in needle biopsy specimens previously reported as negative for malignancy.
16506014 2006 The significance of the P504S expression pattern of high-grade prostatic intraepithelial neoplasia (HGPIN) with and without adenocarcinoma of the prostate in biopsy and radical prostatectomy specimens.
16491480 2006 The prostate-specific G-protein coupled receptors PSGR and PSGR2 are prostate cancer biomarkers that are complementary to alpha-methylacyl-CoA racemase.
16424894 2006 Alpha-methylacyl-CoA racemase as a marker in the differential diagnosis of metanephric adenoma.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15941951 2005 Decreased alpha-methylacyl CoA racemase expression in localized prostate cancer is associated with an increased rate of biochemical recurrence and cancer-specific death.
15941950 2005 Alpha-methylacyl-CoA racemase protein expression is associated with the degree of differentiation in breast cancer using quantitative image analysis.
15880524 2005 A variant of the alpha-methyl-acyl-CoA racemase gene created by a deletion in exon 5 and its expression in prostate cancer.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15330799 2004 Alpha-methylacyl-CoA racemase: a multi-institutional study of a new prostate cancer marker.
15323145 2004 Discovery and clinical application of a novel prostate cancer marker: alpha-methylacyl CoA racemase (P504S).
14960364 2004 Alternative spliced variants of the alpha-methylacyl-CoA racemase gene and their expression in prostate cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612535 2003 Alpha-methylacyl-CoA racemase as an androgen-independent growth modifier in prostate cancer.
12810662 2003 Expression profiling identifies a novel alpha-methylacyl-CoA racemase exon with fumarate hydratase homology.
12673556 2003 Alpha-methylacyl-CoA racemase (P504S) expression in evolving carcinomas within benign prostatic hyperplasia and in cancers of the transition zone.
12512044 2003 Liver disease caused by failure to racemize trihydroxycholestanoic acid: gene mutation and effect of bile acid therapy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438241 2002 Sequence variants of alpha-methylacyl-CoA racemase are associated with prostate cancer risk.
12374981 2002 The polycomb group protein EZH2 is involved in progression of prostate cancer.
12213712 2002 alpha-Methylacyl-CoA racemase: expression levels of this novel cancer biomarker depend on tumor differentiation.
12131161 2002 Alpha-Methylacyl-CoA racemase: a novel tumor marker over-expressed in several human cancers and their precursor lesions.
11956072 2002 Alpha-methylacyl-CoA racemase: a new molecular marker for prostate cancer.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11060344 2000 Mitochondrial and peroxisomal targeting of 2-methylacyl-CoA racemase in humans.
10770938 2000 In mouse alpha -methylacyl-CoA racemase, the same gene product is simultaneously located in mitochondria and peroxisomes.
10655068 2000 Mutations in the gene encoding peroxisomal alpha-methylacyl-CoA racemase cause adult-onset sensory motor neuropathy.
9307041 1997 Molecular cloning of cDNA species for rat and mouse liver alpha-methylacyl-CoA racemases.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7649182 1995 Purification and characterization of an alpha-methylacyl-CoA racemase from human liver.