Property Summary

NCBI Gene PubMed Count 54
PubMed Score 263.23
PubTator Score 55.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 2.862 6.9e-04
glioblastoma 1.300 1.5e-03
group 3 medulloblastoma 2.300 4.5e-03
medulloblastoma, large-cell 1.200 6.4e-05
Atopic dermatitis 2.300 1.4e-03
primary pancreatic ductal adenocarcinoma 1.349 3.2e-03
non-small cell lung cancer 1.419 2.8e-20
intraductal papillary-mucinous neoplasm ... -1.200 4.1e-03
pancreatic cancer 1.100 7.5e-04
pediatric high grade glioma 1.100 1.1e-02
posterior fossa group B ependymoma 1.100 5.7e-03
nasopharyngeal carcinoma 1.200 2.0e-03
Breast cancer 1.900 1.2e-09
invasive ductal carcinoma 1.700 1.2e-03
ovarian cancer 2.000 7.0e-06

Gene RIF (21)

PMID Text
26773052 A short conserved motif in ALYREF directs cap- and exon junction complex-dependent assembly of export complexes on spliced mRNAs.
24753416 HIV-1 Rev specifically inhibits the association of ALY/REF and UAP56 with spliced RRE-containing RNA
24550725 the data provides the first site-specific description of how viral mRNA is locked by a herpes viral adaptor protein in complex with cellular ALYREF, giving herpesvirus access to the cellular mRNA export machinery
23826332 a spatial map is produced in living cells of the sites for the interaction of two TREX subunits, Alyref and Chtop, with Nxf1.
23637401 The interaction of the cellular export adaptor protein Aly/REF with ICP27 contributes to the efficiency of herpes simplex virus 1 mRNA export.
23297349 ALY is a novel E2F2-interacting protein and a relevant modulator of E2F-responsive gene expression.
23242234 High ALY expression is associated with lymph node metastasis in oral squamous cell carcinoma.
23222130 Authors propose that Aly, THO and UAP56 form a highly integrated unit to associate with the spliced mRNA and function in mRNA export.
23125841 HIV-1 Rev specifically inhibits the association of ALY/REF and UAP56 with spliced RRE-containing RNA
22761374 REF/Aly-ORF57 interaction is not essential for KSHV lytic replication but may contribute to target RNA stability independent of effects on RNA export, suggesting a novel role for REF/Aly in viral RNA metabolism.
21329510 A differential connection between tumorogenesis and the expression levels of human THO and ALY.
20981025 When the TREX components UAP56 or Aly are knocked down, spliced mRNA, as well as total polyA+ RNA, accumulates in nuclear speckle domains.
20015986 Results describe the subcellular localization of ICP27 and its colocalization with cellular RNA export factors Aly/REF and TAP/NXF1.
19553338 These results indicate that ICP27 RGG box methylation regulates interaction ALY and SRPK1 proteins.
19369354 TAP/NXF1, but not Aly/REF, is required for RNA export during HSV-1 infection.
19264631 The authors demonstrate that ORF57 recruits several members of hTREX, namely Aly, UAP56 and hTHO-complex proteins, onto the viral mRNAs to assemble an export-competent ribonucleoprotein particle.
19165146 Adaptor Aly functions in the Tap-p15-mediated nuclear export of HSP70 mRNA.
18562279 Aly is a physiological target of nuclear PI3K signaling, which regulates its subnuclear residency, cell proliferation, and mRNA export activities through nuclear Akt phosphorylation and phosphoinositide association.
18243119 Increased TAP binding correlates with increased SF2/ASF binding, but not increased REF/Aly or Y14 binding.
17229714 suggest a central role for ALY in T-cell enhancer function and oncogene activation
15998806 recruitment of the human TREX complex to spliced mRNA is not directly coupled to transcription, but is instead coupled to transcription indirectly through splicing

AA Sequence

MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGG      1 - 70
RNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYD     71 - 140
RSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFG    141 - 210
GGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS                           211 - 257
//

Text Mined References (73)

PMID Year Title
26773052 2016 A short conserved motif in ALYREF directs cap- and EJC-dependent assembly of export complexes on spliced mRNAs.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
24550725 2014 Competitive and cooperative interactions mediate RNA transfer from herpesvirus saimiri ORF57 to the mammalian export adaptor ALYREF.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23826332 2013 Mapping interactions between mRNA export factors in living cells.
23637401 2013 The interaction of the cellular export adaptor protein Aly/REF with ICP27 contributes to the efficiency of herpes simplex virus 1 mRNA export.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
23297349 2013 The nuclear protein ALY binds to and modulates the activity of transcription factor E2F2.
23242234 2013 ALY as a potential contributor to metastasis in human oral squamous cell carcinoma.
23222130 2013 Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22893130 2012 TREX exposes the RNA-binding domain of Nxf1 to enable mRNA export.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22761374 2012 Binding of cellular export factor REF/Aly by Kaposi's sarcoma-associated herpesvirus (KSHV) ORF57 protein is not required for efficient KSHV lytic replication.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22144908 2011 Genome instability and transcription elongation impairment in human cells depleted of THO/TREX.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21329510 2011 Differential expression of THOC1 and ALY mRNP biogenesis/export factors in human cancers.
21269460 2011 Initial characterization of the human central proteome.
21253573 2011 Structural basis for the recognition of cellular mRNA export factor REF by herpes viral proteins HSV-1 ICP27 and HVS ORF57.
20981025 2010 A role for TREX components in the release of spliced mRNA from nuclear speckle domains.
20129943 2010 Arginine methylation of REF/ALY promotes efficient handover of mRNA to TAP/NXF1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20015986 2010 ICP27 phosphorylation site mutants display altered functional interactions with cellular export factors Aly/REF and TAP/NXF1 but are able to bind herpes simplex virus 1 RNA.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19553338 2009 Arginine methylation of the ICP27 RGG box regulates the functional interactions of ICP27 with SRPK1 and Aly/REF during herpes simplex virus 1 infection.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369354 2009 The cellular RNA export receptor TAP/NXF1 is required for ICP27-mediated export of herpes simplex virus 1 RNA, but the TREX complex adaptor protein Aly/REF appears to be dispensable.
19324961 2009 Assembly and mobility of exon-exon junction complexes in living cells.
19264631 2009 Uncoupling of hTREX demonstrates that UAP56 and hTHO-complex recruitment onto herpesvirus saimiri intronless transcripts is required for replication.
19165146 2009 Adaptor Aly and co-adaptor Thoc5 function in the Tap-p15-mediated nuclear export of HSP70 mRNA.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18974867 2008 Recruitment of the complete hTREX complex is required for Kaposi's sarcoma-associated herpesvirus intronless mRNA nuclear export and virus replication.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18562279 2008 Akt phosphorylation and nuclear phosphoinositide association mediate mRNA export and cell proliferation activities by ALY.
18364396 2008 Mutually exclusive interactions drive handover of mRNA from export adaptors to TAP.
18243119 2008 Efficiency of the pioneer round of translation affects the cellular site of nonsense-mediated mRNA decay.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17984224 2008 ATP-dependent recruitment of export factor Aly/REF onto intronless mRNAs by RNA helicase UAP56.
17234882 2007 The Spt6 SH2 domain binds Ser2-P RNAPII to direct Iws1-dependent mRNA splicing and export.
17229714 2007 ALY is a common coactivator of RUNX1 and c-Myb on the type B leukemogenic virus enhancer.
17190602 2006 Human mRNA export machinery recruited to the 5' end of mRNA.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16314458 2005 Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
15998806 2005 Recruitment of the human TREX complex to mRNA during splicing.
15833825 2005 Linking transcriptional elongation and messenger RNA export to metastatic breast cancers.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15047853 2004 Growth-regulated expression and G0-specific turnover of the mRNA that encodes URH49, a mammalian DExH/D box protein that is highly related to the mRNA export protein UAP56.
14730019 2004 eIF4A3 is a novel component of the exon junction complex.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12944400 2003 An evolutionarily conserved role for SRm160 in 3'-end processing that functions independently of exon junction complex formation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438613 2002 ICP27 interacts with the RNA export factor Aly/REF to direct herpes simplex virus type 1 intronless mRNAs to the TAP export pathway.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12176931 2002 Large-scale proteomic analysis of the human spliceosome.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11979277 2002 TREX is a conserved complex coupling transcription with messenger RNA export.
11707413 2001 Magoh, a human homolog of Drosophila mago nashi protein, is a component of the splicing-dependent exon-exon junction complex.
11675789 2001 Pre-mRNA splicing and mRNA export linked by direct interactions between UAP56 and Aly.
11546874 2001 Communication of the position of exon-exon junctions to the mRNA surveillance machinery by the protein RNPS1.
11546873 2001 Role of the nonsense-mediated decay factor hUpf3 in the splicing-dependent exon-exon junction complex.
11118221 2000 The spliceosome deposits multiple proteins 20-24 nucleotides upstream of mRNA exon-exon junctions.
11032328 2000 Human ALY/BEF gene Map position 17q25.3.
10488337 1999 A human nuclear-localized chaperone that regulates dimerization, DNA binding, and transcriptional activity of bZIP proteins.
9952027 1999 Autoantibodies to transcriptional regulation proteins DEK and ALY in a patient with systemic lupus erythematosus.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
9119228 1997 ALY, a context-dependent coactivator of LEF-1 and AML-1, is required for TCRalpha enhancer function.