Property Summary

NCBI Gene PubMed Count 18
PubMed Score 27.48
PubTator Score 30.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 9.8e-03
cystic fibrosis 2.613 6.5e-07
group 3 medulloblastoma 1.600 3.3e-05
posterior fossa group B ependymoma 1.300 3.4e-06

Pathway (1)

Gene RIF (8)

PMID Text
27053613 Knockdown of the CART1 gene significantly inhibited cell invasion and proliferation and induce cell cycle arrest in S phase.
26722397 we identify critical roles of ALX1 in lung cancer development and progression
25736924 we found that depletion of ALX1 caused a dramatic cell cycle arrest, followed by massive apoptotic cell death, and eventually resulted in a significant decrease in migration and invasion of the osteosarcoma cell line studied.
24081945 hypermethylation of HIST1H4F, PCDHGB6, NPBWR1, ALX1, and HOXA9 was significantly associated with shorter survival in stage 1 Non-small-cell lung cancer
23288509 ALX1 upregulated expression of the key EMT regulator Snail (SNAI1) and that it mediated EMT activation and cell invasion by ALX1.
20932315 Observational study of gene-disease association. (HuGE Navigator)
20451171 Disruption of CART1 (ALX1) causes extreme microphthalmia and severe facial clefting.
18976975 Knockdown of ALX homeobox 1 (ALX1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MEFLSEKFALKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSP      1 - 70
CQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFT     71 - 140
SLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDIS    141 - 210
VLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNF    211 - 280
FTDSLLTGATNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM                            281 - 326
//

Text Mined References (19)

PMID Year Title
27053613 2016 [Knockdown of CART1 induces S phase arrest and inhibits invasion and migration of MDA-MB-231 breast cancer cells].
26722397 2015 ALX1 promotes migration and invasion of lung cancer cells through increasing snail expression.
25736924 2015 Depletion of ALX1 causes inhibition of migration and induction of apoptosis in human osteosarcoma.
24081945 2013 A prognostic DNA methylation signature for stage I non-small-cell lung cancer.
23288509 2013 ALX1 induces snail expression to promote epithelial-to-mesenchymal transition and invasion of ovarian cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20932315 2010 Genes encoding critical transcriptional activators for murine neural tube development and human spina bifida: a case-control study.
20451171 2010 Disruption of ALX1 causes extreme microphthalmia and severe facial clefting: expanding the spectrum of autosomal-recessive ALX-related frontonasal dysplasia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12929931 2003 P300/CBP acts as a coactivator to cartilage homeoprotein-1 (Cart1), paired-like homeoprotein, through acetylation of the conserved lysine residue adjacent to the homeodomain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847249 1999 Physical and genetic interactions between Alx4 and Cart1.
9753625 1998 Human CART1, a paired-class homeodomain protein, activates transcription through palindromic binding sites.
8756334 1996 Human Cart-1: structural organization, chromosomal localization, and functional analysis of a cartilage-specific homeodomain cDNA.
8673125 1996 Prenatal folic acid treatment suppresses acrania and meroanencephaly in mice mutant for the Cart1 homeobox gene.
7690966 1993 Cartilage homeoprotein 1, a homeoprotein selectively expressed in chondrocytes.
7592751 1995 Presence of a new conserved domain in CART1, a novel member of the tumor necrosis factor receptor-associated protein family, which is expressed in breast carcinoma.