Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.89
PubTator Score 2.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Blepharitis 23 3.849 1.9

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma -1.100 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.700 7.4e-03
lung cancer -1.200 2.3e-03
lung carcinoma -1.200 3.8e-18
malignant mesothelioma -1.200 3.3e-06
osteosarcoma -1.450 8.1e-04

Gene RIF (4)

AA Sequence

MCNPEEAALLRLEEVFSATLAHVNSLVLQPLLPAAPDPSDPWGRECLRLLQQLHKSSQQLWEVTEESLHS      1 - 70
LQERLRYPDSTGLESLLLLRGADRVLQAHIEYIESYTSCMVVQAFQKAAKRRSEYWRGQRKALRQLLSGV     71 - 140
SSEGSVGASLGQALHQPLAHHVQQYVLLLLSLGDTIGEHHPTRELVVNAVTLFGNLQSFMKQELDQAVAT    141 - 210
QALWHTLRGRLRDVLCTPAHRLLQDSQDVPVTVAPLRAERVLLFDDALVLLQGHNVHTFDLKLVWVDPGQ    211 - 280
DGCTFHLLTPEEEFSFCAKDSQGQAVWQWKVTWAVHQALHGKKDFPVLGAGLEPSQPPDCRCAEYTFQAE    281 - 350
GRLCQATYEGEWCRGRPHGKGTLKWPDGRNHVGNFCQGLEHGFGIRLLPQASEDKFDCYKCHWREGSMCG    351 - 420
YGICEYSTDEVYKGYFQEGLRHGFGVLESGPQAPQPFRYTGHWERGQRSGYGIEEDGDRGERYIGMWQAG    421 - 490
QRHGPGVMVTQAGVCYQGTFQADKTVGPGILLSEDDSLYEGTFTRDLTLMGKGKVTFPNGFTLEGSFGSG    491 - 560
AGRGLHTQGVLDTAALPPDPSSTCKRQLGVGAFPVESRWQGVYSPFRDFVCAGCPRDLQEALLGFDVQSS    561 - 630
RELRRSQDYLSCERTHPEDSVGSMEDILEELLQHREPKALQLYLRKALSNSLHPLGKLLRTLMLTFQATY    631 - 700
AGVGANKHLQELAQEEVKQHAQELWAAYRGLLRVALERKGQALEEDEDTETRDLQVHGLVLPLMLPSFYS    701 - 770
ELFTLYLLLHEREDSFYSQGIANLSLFPDTQLLEFLDVQKHLWPLKDLTLTSNQRYSLVRDKCFLSATEC    771 - 840
LQKIMTTVDPREKLEVLERTYGEIEGTVSRVLGREYKLPMDDLLPLLIYVVSRARIQHLGAEIHLIRDMM    841 - 910
DPNHTGGLYDFLLTALESCYEHIQKEDMRLHRLPGHWHSRELW                               911 - 953
//

Text Mined References (13)

PMID Year Title