Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.13
PubTator Score 243.07

Knowledge Summary

Patent (3,994)

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.935 4.8e-05
ependymoma 1.200 4.8e-08
tuberculosis 1.100 1.5e-05
pancreatic ductal adenocarcinoma liver m... 1.466 2.7e-03
intraductal papillary-mucinous adenoma (... 1.200 9.7e-04
intraductal papillary-mucinous neoplasm ... 1.800 1.0e-03
breast carcinoma 2.000 1.8e-02
subependymal giant cell astrocytoma 1.650 1.2e-02
lung carcinoma -2.500 4.7e-43
ovarian cancer -1.300 9.5e-09

Gene RIF (7)

PMID Text
25326865 findings suggest that among genes in a gout-susceptibility locus, not ALPK1 but ABCG2 could be important as a gout-susceptible gene
23569188 single nucleotide polymorphisms in the alpha-protein kinase 1 (ALPK1) gene are associated with gout in Han Chinese Taiwanese.
23539754 ALPK1 may be a susceptibility gene for chronic kidney disease in such individuals with diabetes mellitus.
21822924 ALPK1 is a gout-susceptible gene involved in Monosodium urate monohydrate-induced inflammatory responses and may contribute to the development of gout by enhancing the inflammatory responses via the MAP kinase pathway
21208416 Transposon-inserted Alpk1 homozygous mutant mice display severe defects in motor coordination in a series of behavioral analyses.
20332099 Observational study of gene-disease association. (HuGE Navigator)
15883161 the phosphorylation of myosin I by ALPK1 is an essential process in the apical trafficking of raft-associated sucrose-isomaltase

AA Sequence

MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQ      1 - 70
AVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPA     71 - 140
TPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMW    141 - 210
YEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAE    211 - 280
ACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTGKQE    281 - 350
LHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQ    351 - 420
VQSFSNVDDRSYVPESFECRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESDCGNNKNEQKDAKTGVCI    421 - 490
TALKTEIKNIDTVSTTQEKPHCQRDTGISSSLMGKNVQRELRRGGRRNWTHSDAFRVSLDQDVETETEPS    491 - 560
DYSNGEGAVFNKSLSGSQTSSAWSNLSGFSSSASWEEVNYHVDDRSARKEPGKEHLVDTQCSTALSEELE    561 - 630
NDREGRAMHSLHSQLHDLSLQEPNNDNLEPSQNQPQQQMPLTPFSPHNTPGIFLAPGAGLLEGAPEGIQE    631 - 700
VRNMGPRNTSAHSRPSYRSASWSSDSGRPKNMGTHPSVQKEEAFEIIVEFPETNCDVKDRQGKEQGEEIS    701 - 770
ERGAGPTFKASPSWVDPEGETAESTEDAPLDFHRVLHNSLGNISMLPCSSFTPNWPVQNPDSRKSGGPVA    771 - 840
EQGIDPDASTVDEEGQLLDSMDVPCTNGHGSHRLCILRQPPGQRAETPNSSVSGNILFPVLSEDCTTTEE    841 - 910
GNQPGNMLNCSQNSSSSSVWWLKSPAFSSGSSEGDSPWSYLNSSGSSWVSLPGKMRKEILEARTLQPDDF    911 - 980
EKLLAGVRHDWLFQRLENTGVFKPSQLHRAHSALLLKYSKKSELWTAQETIVYLGDYLTVKKKGRQRNAF    981 - 1050
WVHHLHQEEILGRYVGKDYKEQKGLWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILE   1051 - 1120
DKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLI   1121 - 1190
YLTDPQIHSVDQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKPCT                   1191 - 1244
//

Text Mined References (21)

PMID Year Title
25326865 2015 Common variant of ALPK1 is not associated with gout: a replication study.
23569188 2013 ALPK1 genetic regulation and risk in relation to gout.
23539754 2013 Identification of chromosome 3q28 and ALPK1 as susceptibility loci for chronic kidney disease in Japanese individuals by a genome-wide association study.
22484627 2012 A genome-wide association meta-analysis identifies new childhood obesity loci.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21822924 2011 Lymphocyte ?-kinase is a gout-susceptible gene involved in monosodium urate monohydrate-induced inflammatory responses.
21799462 2011 Genome-wide association study of epirubicin-induced leukopenia in Japanese patients.
21208416 2011 Motor coordination deficits in Alpk1 mutant mice with the inserted piggyBac transposon.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15883161 2005 Alpha-kinase 1, a new component in apical protein transport.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10021370 1999 Alpha-kinases: a new class of protein kinases with a novel catalytic domain.