Property Summary

NCBI Gene PubMed Count 246
PubMed Score 1353.02
PubTator Score 1830.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (25)

Disease log2 FC p
psoriasis 1.100 9.2e-03
glioblastoma 3.000 1.2e-04
osteosarcoma -3.644 1.3e-03
group 4 medulloblastoma -2.000 2.1e-04
astrocytoma 2.500 3.8e-02
periodontitis 1.100 9.4e-22
medulloblastoma, large-cell -2.900 3.2e-04
adrenocortical carcinoma -2.125 2.3e-03
chronic kidney disease 2.500 4.1e-03
pancreatic ductal adenocarcinoma liver m... 2.241 3.0e-02
non-small cell lung cancer -3.025 8.8e-22
lung cancer -4.400 3.1e-05
interstitial cystitis -2.100 6.2e-05
cystic fibrosis -2.700 1.2e-05
pilocytic astrocytoma 1.500 2.2e-04
primary Sjogren syndrome 2.000 3.6e-04
lung adenocarcinoma -2.001 2.2e-04
invasive ductal carcinoma 2.442 3.6e-05
Endometriosis -1.173 3.7e-02
lung carcinoma -2.100 3.8e-19
Breast cancer -2.100 7.0e-08
mucosa-associated lymphoid tissue lympho... 2.068 1.1e-02
ulcerative colitis 3.400 5.2e-08
ovarian cancer 3.500 9.3e-06
dermatomyositis 1.400 2.2e-03

Gene RIF (231)

PMID Text
26852002 the Alox-5 gene might play a role in the differentiation of multiple drug resistant and non-resistant erythroleukemic cell lines
26707712 our data suggest that the inhibition of both COX-2/5-LOX may be an effective therapeutic approach for colon cancer management, particularly for those patients with high expression of COX-2/5-LOX
26505400 we identified differences in the frequency distribution in the Tibetan population located in the ALOX5 , VKORC1 and PTGS2 genes
26427761 The study explores the substrate access portal of 5-Lipoxygenase.
26378572 Increased PUFA Content and 5-lipoxygenase pathway expression are associated with subcutaneous adipose tissue inflammation in obese women with type 2 diabetes.
26334317 These results suggest that COX-2 and 5-LO play roles in tumorigenesis and the progression of primary glioblastoma and that the co-expression pattern of COX-2/5-LO may be used as an independent prognostic factor in this disease.
26329759 AF4 and AF4-MLL mediate transcriptional elongation of 5-lipoxygenase mRNA by 1, 25-dihydroxyvitamin D3.
26327594 THE 5-LOX interface involving the four cysteines 159, 300, 416 and 418 is important for the translocation to the nuclear membrane and the colocalization with FLAP.
26210919 The study shows that 5-lipoxygenase (5-LO) in B cells is phosphorylated on Ser523 and demonstrates for the first time a chemical difference between 5-LO in myeloid cells and B cells.
26173130 investigated potential mechanisms by which 5-LO13 interferes with 5-LO product biosynthesis in transfected HEK293 cells
26076991 GSAP cleavage via caspase-3 is regulated and depend upon the availability of 5-Lipoxygenase in Alzheimer's disease.
26070487 Genotoxic stress induces the ALOX5 mRNA and protein expression in a p53-dependent manner.
25721704 Report no association between ALOX5 SNPs and atherosclerotic plaque phenotypes.
25540201 These findings indicate that the oncogenic function of c-Myc in prostate cancer cells is regulated by 5-Lox activity, revealing a novel mechanism of 5-Lox action
25483364 Results suggest that the level of 5-LOX expression was increased in pancreatic cancer tissues and may be related to lymph node metastasis and TNM stage.
25454978 contributes to inflammatory microenvironment of precancerous pancreatic lesions
25359714 Two of the most potent/selective inhibitors (HIR-303 and HIR-309) were reductive inhibitors and were potent against 5-LOX in human whole blood, indicating that isoflavans can be potent and selective inhibitors against human leukocyte 5-LOX
25309925 5-LOX inhibition reduced apoptotic death, restored the initial IL-2/INF-gamma ratio, and more importantly reverted micro-calpain activation induced by simulated microgravity.
25229347 involvement of lipoxygenase pathways in TNF-alpha-induced production of cytokines and chemokines
25218842 Study identified a novel splice variant of 5-LO consisting of 139 amino acids due to premature stop. It was found to be expressed in HepG2 cells only, raising the possibility for putative role in liver cancer development.
25193960 Low leukotriene B4 receptor 1 leads to ALOX5 downregulation at diagnosis of chronic myeloid leukemia.
24746852 Human cytomegalovirus (HCMV) induced up-regulation of 5-lipoxygenase in both ex vivo HCMV-infected placental explants and human umbilical vein endothelial cells (HUVEC)
24662827 Increased metabolites of 5-lipoxygenase from hypoxic ovarian cancer cells promote tumor-associated macrophage infiltration.
24480307 Mutation of Arg101 to Asp in intact 5-LOX leads to increased activity.
24350867 The 5-LOX/LTC4 /CysLT1 signaling pathway regulates EGF-induced cell migration by increasing Tiam1 expression.
24335295 Inhibition of the 5-lipoxygenase/LTB4 pathway could potentially be used in treatment to control Kaposi's sarcoma and primary effusion lymphoma.
24226420 5-LO disruption improves wound healing and alters fibroblast function by an antioxidant mechanism based on HO-1 induction.
24162774 HIV-1 gp120 downregulates the expression of arachidonate 5-lipoxygenase (ALOX5) in human B cells
24130502 we demonstrate that the upregulation of Alox5 by RUNX1-ETO9a occurs via the CH zinc finger transcription factor KLF6, a protein required for early hematopoiesis and yolk sac development
24036216 Jurkat T cells overexpressing 5-LO failed to activate PPARgamma in macrophages, while their 5-LO overexpressing apoptotic counterparts did.
24005813 Polymorphisms within FLT3, EGFR, NEIL3, and ALOX5 may contribute to the occurrence of GBM.
23828562 The results of our study failed to confirm whether the selected variants in ALOX5 gene within the LT metabolism pathway contribute to platelet reactivity in a diabetic population treated with ASA.
23752617 Studies indicate that suppression of 5-lipoxygenase (5-LOX) activity reduces the cell proliferation activity and induces intrinsic mitochondrial apoptotic pathway.
23746795 The results indicated that the individuals bearing AA genotype of ALOX5AP1 SG13S114T/A polymorphism are more prone to stroke and bad outcome as well as with aspirin resistance than TA and TT genotypes.
23727898 A significant increase was found in 5-lipoxygenase gene expression in Alzheimer's disease patients compared to controls.
23720274 LPS-induced Mac-1 expression on monocytes was significantly inhibited by pre-treatment with U-75302, a BLT1-receptor antagonist, suggesting a pivotal role of 5-LO-derived leukotrienes
23642263 UPF1 is a critical gene expression regulator of 5-lipoxygenase and other proteins in the monocytes.
23600541 ALOX5 polymorphism associates with increased leukotriene production and reduced lung function and asthma control in children with poorly controlled asthma.
23572152 The changes of LTB4 concentration in serum and the mRNA expression level of 5-LO in decidua may play an important role in the success and maintenance of a healthy pregnancy.
23485709 The inhibition of 5-lipoxygenase blocks the release of organic osmolytes and the concomitant cell volume restoration following hypoosmotic swelling of A549 cells.
23448388 Our study is the first to show that ALOX5 is associated with susceptibility to pediatric TB in a subset of children in northern China. The rs2115819 T allele of ALOX5 presents a risk factor for childhood TB disease.
23351835 Adipose tissue arachidonic acid content is associated with the expression of 5-lipoxygenase in atherosclerotic plaques.
23332172 A novel functional role for neuronal 5-lipoxygenase shows modulation of tau phosphorylation.
23179791 Data indicate that focal adhesion kinase (FAK) activation and cell migration require Src, Gi/Go, COX-2 and LOXs activities.
23079635 5-lipoxygenase is involved in the maintenance of normal dopamine function in the striatum.
23079278 genetic association studies in population of Han Chinese in Eastern China: Using a recessive genetic model, an SNP in ALOX5 (rs2029253) is associated with reduced risk of ischemic stroke.
23067353 The Sp1 promoter repeat variants of ALOX5 were found to be associated with coronary artery disease.
22825379 increased 15-LOX-1 and decreased 5- and 12-LOX levels at the onset of kidney cancer reversing with the progressing stage of the disease or the grade of tumor
22808264 The functional interaction between Acyl-CoA synthetase 4, 5-lipooxygenase and cyclooxygenase-2 controls tumor growth.
22739369 These findings indicate that the efficacy of fish oil supplements vary by ALOX5 genotype.
22690932 The aim of this study was to evaluate the immunohistochemical expression of 5-LOX pathway proteins in oesophageal adenocarcinoma and its premalignant lesion, Barrett's metaplasia
22616993 evidence for epigenetic modifications of valvular interstitial cells in valvular heart disease
22516296 phosphorylation of 5-LOX at S663 not only down-regulates leukotriene synthesis but also stimulates lipoxin production in inflammatory cells that do not express 15-LOX, redirecting lipid mediator biosynthesis to the production of mediators of inflammation.
22433003 Licofelone inhibits IL-18-induced 5-lipoxygenase enzyme activity in human mesangial cells.
22363630 The coupling of alternative splicing and nonsense-mediated mRNA decay is involved in the regulation of 5-LO gene expression.
22293202 the lipid metabolism enzyme 5-LOX and its metabolite LTB4 are capable of activating transcription factor NF-kappaB in hepatoma cells.
22282663 inherited variation in IL1A and ALOX5 seems to affect ovarian cancer risk
22253131 study suggests that ALOX5 can enhance invasion in PTC through a 5-HETE dependent induction of MMP-9, and demonstrates a relationship ALOX5 can enhance invasion in papillary thyroid carcinoma through a 5(S)-hydroxyeicosatetraenoic acid dependent induction of MMP-9, and demonstrates a relationship between ALOX5 and tumor invasion not been previously described
22050225 The bioinformatic analysis of the 5-LO surface for putative protein-protein interaction domains and molecular modeling of the dimer interface suggests a head to tail orientation of the dimer which also explains the localization of previously reported ATP binding sites.
21883892 Only class I histone deacetylase inhibitors induce 5-LO promoter activity. Induction of 5-LO mRNA expression correlated with histone H3 lysine 4 trimethylation.
21729626 The SNPs of ALOX(5)AP and LTC(4)S are associated with asthma.
21723968 arachidonate 5-lipoxygenase can be considered for validation as a potential marker for diagnosis of tuberculous meningitis.
21605700 the expression and activity of both cyclooxygenase-2 and lipoxygenase-5 was markedly increased in two different cell culture models of cystic fibrosis
21540635 genetic polymorphism is associated with white blood cell counts in workers exposed to benzene
21482803 Biosynthesis of hemiketal eicosanoids by cross-over of the 5-lipoxygenase and cyclooxygenase-2 pathways.
21403093 The upregulation of the LT pathway in human aortic valve stenosis taken together with the potentially detrimental LT-induced effects on valvular myofibroblasts, suggests one possible role of inflammation in the development of aortic stenosis
21314617 The interaction between ceruloplasmin of human plasma, and 5-lipoxygenase, the key enzyme of leukotriene synthesis, is shown for the first time
21296957 ALOX5 gene variants affect eicosanoid production and response to fish oil supplementation.
21233389 identified a 5-LOX-specific destabilizing sequence involved in orienting the carboxyl terminus, which binds the catalytic iron; report the crystal structure at 2.4 angstrom resolution of 5-LOX stabilized by replacement of this sequence
21224059 these results illustrate the novel role of Alox5 in adaptive humoral immunity by managing primary B cells and Tfh cells in vivo.
21200133 alternative ROS production pathway that is triggered by CD40 ligation, involves 5-lipoxygenase (5-LO), and results in activation of p38 MAPK
21098726 alternative 5-LO isoforms may represent a new mechanism for the regulation of the 5-LO pathway and lipid mediator biosynthesis
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20592751 Observational study of gene-disease association. (HuGE Navigator)
20549218 The results support the role of 5-LOX in early stages of colon carcinogenesis.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20388081 Observational study of gene-disease association. (HuGE Navigator)
20382140 The mRNA levels of ALOX5 implicated pathways differed significantly in gliomas according to the histological type.
20372792 Cyclooxygenase-2 and 5-lipoxygenase pathways have roles in diosgenin-induced apoptosis in HT-29 and HCT-116 colon cancer cells
20198315 Observational study of gene-disease association. (HuGE Navigator)
20173757 A natural mutant of hepatitis B virus X gene (HBx) with a deletion from 382 to 401 base pairs (termed HBxDelta127), promotes hepatoma cell growth through activating SREBP-1c involving 5-LOX.
20128419 no association between gene polymorphism and bronchial asthma in a Spanish population
20126469 HBxDelta127 promotes cell growth through a positive feedback loop involving 5-LOX and fatty acid synthase
20110601 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19919819 The 5-lipoxygenase-leukotriene A4 pathway might play roles in the proliferation of human glioma cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19888660 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19807693 Results of the present study support a role for CLP as a chaperoning scaffold factor, influencing both the stability and the activity of 5-LO.
19724895 Observational study of gene-disease association. (HuGE Navigator)
19717473 The shorter repeat alleles of the 5-LO promoter lead to higher gene expression.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19524426 Observational study of gene-disease association. (HuGE Navigator)
19497113 5-LO is expressed in synovial tissue, mainly in macrophage-like cells from patients with rheumatoid arthritis; 5-LO enzyme, however, is not detected in T- or B-lymphocytes from these synovial biopsies.
19473080 Genotyping the GGGCGG tandem repeat promoter polymorphism in ALOX5 by pyrosequencing assay is reported.
19473080 Observational study of genetic testing. (HuGE Navigator)
19450127 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19446447 one in the promoter and one spanning six SNPs from rs3740107G>A in intron 6 to rs2229136A>G in exon 13.five-repeat genotype was the most frequent Sp1/Egr1 promoter tandem repeat variant
19423540 Nine SNPs distributed across eight genetic regions (ALOX5, IRAK3, ITGB2, NCF2, NFKB1, SELP, SOD1, and STAT1) were associated with risk of glioma with P value of <0.01.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19390118 5-LO was the enzyme responsible for the generation of the HepsilondGuo DNA-adduct in CESS cells.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19233132 LTC(4)S interacts in vitro with both FLAP and 5-LO and that these interactions involve distinct parts of LTC(4)S.
19224689 5-LOX protein expression in human bronchial epithelial cells can be regulated by benzidine.
19214143 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19134178 a role of the 5-LO pathway in B cells before the cells finally differentiate to plasma cells
19131661 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19130089 Observational study of gene-disease association. (HuGE Navigator)
19083497 Grape seed and red wine polyphenol extracts inhibit this enzyme in seveal tumor cell lines.
19075240 identify multiprotein complexes for leukotriene synthesis on the outer and inner nuclear membranes of mast cells and neutrophils, centered on the 5-Lipoxygenase-Activating Protein and 5-Lipoxygenase
19053751 microsomal prostaglandin E2 synthase-1 and 5-lipoxygenase can be inhibited by pirinixic acid derivatives
19022417 Results suggest that the formation of miRNAs may be regulated by 5LO in leukocytes and cancer cells expressing this lipoxygenase.
18996667 The development of methodology for clinical measurement of ALOX5 intermediates from peripheral blood mononuclear cells is reported.
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18991687 The pro-inflammatory alleles of COX-2 and 5-LO were overrepresented in MI and under-represented in centenarians whereas age-related controls displayed intermediate values
18978352 nuclear import, which is regulated by phosphorylation on Ser-523, to determine the subcellular distribution of 5-LO, which in turn regulates leukotriene biosynthesis.
18976020 There is a relationship between 5-LO expression and the neoangiogenesis process as reflected by intratumoral microvessel density in human sporadic colorectal adenocarcinomas.
18927292 5-LOX is overexpressed in adenomatous polyps and cancer.
18843019 No significant effect of ALOX5 genotype on breast cnacer risk.
18842779 The 3 and 4 variants lead to higher 5-LO expression and provide additional evidence that these alleles are associated with greater risks of atherosclerosis and MI in the context of a high-AA diet.
18842779 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18678882 5-lipoxygenase is upregulated in the Alzheimer's disease hippocampus.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18571838 Report the long-term effect of Helicobacter pylori eradication on COX-1/2, 5-LOX and leukotriene receptors in patients with a risk gastritis phenotype--a link to gastric carcinogenesis.
18525291 Observational study of gene-disease association. (HuGE Navigator)
18421434 Role of ALOX5 in pancreatic function in human islets is assessed through short interfering RNA (siRNA) knockdown experiments.
18421027 5-LOX was expressed in 6% of ovarian neoplasms.
18398223 Observational study of gene-disease association. (HuGE Navigator)
18369664 findings do not support a link between common allelic variation in or near ALOX5 or ALOX5AP and the risk of coronary artery disease
18369664 Observational study of gene-disease association. (HuGE Navigator)
18366797 Observational study of gene-disease association. (HuGE Navigator)
18339529 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18295198 Describe an ex vivo human whole blood assay to evaluate the efficacy and selectivity of 5-LOX inhibitors.
18280718 Results describe the cyclooxygenase (COX) and 5-lipoxygenase (5-LOX) selectivity of COX inhibitors.
18218859 Tertiary-butanolcauses moderate suppression of 5-LO and hardly inhibits 5-LO translocation in polymorphonuclear leukocytes.
18204779 Observational study of gene-disease association. (HuGE Navigator)
18204779 These results suggest that E254K in the 5-LO might be associated with bronchial asthma.
18180307 CMV infection induces 5-lipoxygenase expression and leukotriene B4 production in vascular smooth muscle cells
18179798 variant 5-lipoxygenase promoter genotypes do not have a major role in myocardial infarction
18179798 Observational study of gene-disease association. (HuGE Navigator)
18174194 The observation of an association of ALOX5 variants with susceptibility to tuberculosis contributes evidence of the importance of 5-LO products to the regulation of immune responses to M. tuberculosis.
18174194 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17924829 Observational study of gene-gene interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17909879 data do not provide consistent evidence of association between genomic variation in ALOX5 and clinical variability in aBMD in healthy
17909879 Observational study of gene-disease association. (HuGE Navigator)
17894944 TsA increases 5-LO promoter activity by the enhanced recruitment of Sp1 and Sp3 to the 5-LO promoter
17825794 These results suggest that overexpression of 5-LO and LTB(4) in atherosclerotic plaques possibly promote MMP-induced plaque rupture in diabetes.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17616938 5-Lipooxygenase up-regulation is an important step in renal cancer progression.
17521309 Observational study of gene-disease association. (HuGE Navigator)
17500032 In silico screening of the whole 5-LO gene area (84 kb, including 10 kb promoter region) was performed and 22 putative vitamin D response elements were identified.
17467166 involved in tumor progression of several cell types and may also participate in lymphomagenesis, especially Epstein Barr virus-mediated.
17460547 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17460547 CYSLTR2 and ALOX5 polymorphisms may predispose a minority of individuals to excessive cysteinyl-leukotriene concentrations, yielding a distinct asthma phenotype most likely to respond to leukotriene modifier pharmacotherapy.
17434678 Suppression of 5-lipoxygenase gene is involved in triptolide-induced apoptosis in pancreatic tumor cell lines.
17373938 Observational study of gene-disease association. (HuGE Navigator)
17373938 The data did not support a significant effect of ALOX5-promoter polymorphism on MI risk.
17373700 Observational study of gene-disease association. (HuGE Navigator)
17236225 Observational study of gene-disease association. (HuGE Navigator)
17236225 no significant associations of the 2 5-LOX polymorphisms with the risk of colorectal adenoma
17115186 Observational study of gene-disease association. (HuGE Navigator)
17115186 Multiple ALOX5 single nucleotide polymorphisms (SNPs) independently predict severe carotid artery disease.
17080223 platelet-stimulated proliferation of fibroblasts is mediated by an increased 5-LO activity
17072961 results suggest that 5-lipoxygenases is up-regulated in colorectal cancer and that inhibition of its expression might be valuable in the prevention and treatment of colorectal cancer
17018618 ANXA7 and p53 can distinctly regulate LOX transcription that is potentially relevant to the arachidonic acid -mediated cell growth control in tumor suppression.
16924104 Coactosin-like protein (CLP) up-regulates Ca(2+)-induced 5-lipoxygenase (5LO) activity, and increases the amount of Leukotriene A(4) formed by 5LO.
16919603 Sequence analysis and deletion studies indicate the existence of up to four Smad binding elements and at least one TGFbeta responsive element far downstream of the transcriptional start site of the 5-lipoxygenase gene.
16899822 human 5-lipoxygenase is inhibited by dihydroxydocosahexaenoic acids of the neuroprotectin D family
16750418 analysis of vitamin D receptor (VDR) binding to putative vitamin D response elements within the 5-LO promoter and analysis its function
16733792 The stratified squamous epithelial cells from inflamed or hyperplastic tissues of palatine and pharyngeal tonsils (nasopharyngeal-associated lymphoid tissue) express 5-lipoxygenase protein.
16698924 5-lipoxygenase and leukotriene A4 hydrolase expression in atherosclerotic lesions correlates with symptoms of plaque instability
16672272 The binding between human 5-lipoxygenase with its inhibitors can be investigated by SPR technology and molecular docking simulation.
16537708 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16531984 Administration of omega-3 reduced significantly ALOX5 activity, with no effect on ALOX5 protein expression.
16495221 a critical regulatory role of arachidonate reacylation that limits leukotriene biosynthesis in concert with 5-lipoxygenase and cytosolic phospholipase A(2)alpha activation
16413224 the GC-rich part of the 5-lipoxygenase gene promoter, including a novel Sp1 site, appear important for basal (rather than upregulated) transcription of 5-lipoxygenase gene in monocytic cells
16402861 mizolastine down-regulated 5-LOX mRNA expression and inhibited 5-LOX translocation from nucleus to cytoplasm in fibroblasts
16385451 Observational study of gene-disease association. (HuGE Navigator)
16364163 Observational study of gene-disease association. (HuGE Navigator)
16361798 Observational study of gene-disease association. (HuGE Navigator)
16361798 the polymorphism of ALOX5 at positions of -1708 G > A showed significant difference in genotype frequency between aspirin-intolerant urticaria and aspirin-intolerant asthma
16293801 Observational study of gene-disease association. (HuGE Navigator)
16275640 Arachidonic acid regulates the translocation of 5-LO in human neutophild unraveling a novel mechanism of the cAMP-mediated inhibition of leukotriene biosynthesis
16165096 Nuclear export of 5-LO depends on the stress-induced activation of the p38 MAPK pathway.
16135563 results suggest that splitting of BL41-E95-A cells induces de novo synthesis of a protein involved in the activation of casp-6 and casp-8, which cleaves 5-LO.
15933245 The expression of 5-LO is elevated in symptomatic compared with asymptomatic plaques and is associated with acute ischemic syndromes
15923196 In the absence of Ca2+ (chelated using EDTA), OAG strongly and concentration-dependently stimulated 5-LO enzyme from polymorphonuclear leukocytes
15848143 Mutagenesis of 5LO C-terminal mutants showed that hidrogen bonds are required for a stabilizing C-terminal loop.
15661803 Increased 5-lipoxygenase expression is associated with esophageal cancer
15616590 Data show that 5-lipoxygenase activity increases during senescence-like growth arrest via a p53/p21-dependent pathway in both human and mouse embryo fibroblasts.
15308583 Observational study of gene-disease association. (HuGE Navigator)
15308583 polymorphisms in arachidonate 5-lipoxygenase is associated with colon cancer risk
15301234 Expression of 5-lipoxygenase mRNA was observed in muscle tissues from patients with idiopathic inflammatory myopathies suggesting a role in pathogenesis of this disease.
15280375 PKA phosphorylates 5-LO on Ser-523, which inhibits the catalytic activity of 5-LO and reduces cellular LT generation
15219851 determination of binding sites for calcium and magnesium
15010818 Up-regulation of 5-Lipoxygenase is associated with prostate cancer
14767568 increased expressions of 5-LOX and 12-LOX were detected in testicular cancer tissues
14749922 Observational study of gene-disease association. (HuGE Navigator)
14749922 possible involvement of 5-lipoxygenase (ALOX5) gene polymorphism in ASA-intolerant asthma (AIA) in a Korean population
14532840 Lipoxygenase is induced in bladder cancer. Results suggest that lipoxygenase inhibitors may mediate potent antiproliferative effects against bladder cancer cells.
12911785 Observational study of gene-disease association. (HuGE Navigator)
12907138 human breast tumours aberrantly express significantly higher levels of 5-lipoxygenase; levels of 5-lipoxygenases were also particularly high in tumours from patients who died of breast cancer.
12893830 5-lipoxygenase can be activated by calcium and low levels of hydroperoxides
12859962 Data show that inhibition of arachidonate 5-lipoxygenase induces rapid activation of c-Jun N-terminal kinase (JNK) in human prostate cancer cells which is prevented by the 5-lipoxygenase metabolite, 5(S)-HETE.
12751769 upregulation in glioblastoma multiforme
12751768 upregulated in colon cancer; affecting cell survival
12751728 LTC4 production by eosinophils in asthmatic subjects with alternative forms of ALOX-5 core promoter
12730086 CON6 mouse point mutations (I645V and V646I) as well as the double mutant (I645V+V646I) introduced by site-directed mutagenesis into human 5-LO exhibited reduced catalytic activities but retained their positional specificity & substrate affinity.
12664574 examines the binding of calcium to this enzyme (REVIEW)
12629151 LOX5 and FLAP pathway in monocytes and microglia yields products toxic toward neurons (neuroblastoma cell line)
12525578 results demonstrating mechanisms for activation of 5-LO differ considerably between cell types
12354292 HIV-1 gp120 downregulates the expression of arachidonate 5-lipoxygenase (ALOX5) in human B cells
12234060 there is no evidence of increased expression of 5-LO mRNA in either quiescent or active stages of inflammatory bowel disease
12163367 marked expression of 5-LOX in human pancreatic cancer tissues
12140292 Data show that the previously identified bipartite-motif region within 5-lipoxygenase is not a functional import sequence, whereas the newly identified basic region constitutes a true nuclear import sequence.
12111389 Theoretical model of the tertiary structure of the 5-lipoxygenase catalytic domain, using the resolved structure of rabbit 15-lipoxygenase as a template.
12107604 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11844797 promotion of phosphorylation at Ser-271 by MAPK-activated protein kinase 2 and arachidonic acid
11796736 molecular basis of the specific subcellular localization of the C2-like domain
11471199 Uncategorized study of gene-disease association and gene-environment interaction. (HuGE Navigator)
9639560 HIV-1 gp120 downregulates the expression of arachidonate 5-lipoxygenase (ALOX5) in human B cells

AA Sequence

MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRI      1 - 70
EKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQ     71 - 140
KQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEK    141 - 210
IFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQG    211 - 280
NIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLL    281 - 350
AKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG    351 - 420
LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVV    421 - 490
DIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYD    491 - 560
WCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKP    561 - 630
VKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI                              631 - 674
//

Text Mined References (250)

PMID Year Title
26852002 2016 Cell differentiation and the multiple drug resistance phenotype in human erythroleukemic cells.
26707712 2016 Dual inhibition of COX-2/5-LOX blocks colon cancer proliferation, migration and invasion in vitro.
26505400 2015 Genetic polymorphisms in very important pharmacogenomic (VIP) variants in the Tibetan population.
26427761 2015 Identification of the Substrate Access Portal of 5-Lipoxygenase.
26378572 2015 Increased PUFA Content and 5-Lipoxygenase Pathway Expression Are Associated with Subcutaneous Adipose Tissue Inflammation in Obese Women with Type 2 Diabetes.
26334317 2015 Co-expression of COX-2 and 5-LO in primary glioblastoma is associated with poor prognosis.
26329759 2015 AF4 and AF4-MLL mediate transcriptional elongation of 5-lipoxygenase mRNA by 1, 25-dihydroxyvitamin D3.
26327594 2015 Characterization of the interaction of human 5-lipoxygenase with its activating protein FLAP.
26210919 2015 Phosphorylation of serine 523 on 5-lipoxygenase in human B lymphocytes.
26173130 2015 The Intracellular Localisation and Phosphorylation Profile of the Human 5-Lipoxygenase ?13 Isoform Differs from That of Its Full Length Counterpart.
26076991 2015 Regulation of gamma-secretase activating protein by the 5Lipoxygenase: in vitro and in vivo evidence.
26070487 2015 5-Lipoxygenase is a direct p53 target gene in humans.
25721704 2015 Variants in ALOX5, ALOX5AP and LTA4H are not associated with atherosclerotic plaque phenotypes: the Athero-Express Genomics Study.
25540201 2015 Inhibition of 5-lipoxygenase selectively triggers disruption of c-Myc signaling in prostate cancer cells.
25483364 2015 Inhibition of 5-lipoxygenase triggers apoptosis in pancreatic cancer cells.
25454978 2015 Ablation of 5-lipoxygenase mitigates pancreatic lesion development.
25416956 2014 A proteome-scale map of the human interactome network.
25359714 2015 Enzymatic Studies of Isoflavonoids as Selective and Potent Inhibitors of Human Leukocyte 5-Lipo-Oxygenase.
25309925 2014 A functional interplay between 5-lipoxygenase and ?-calpain affects survival and cytokine profile of human Jurkat T lymphocyte exposed to simulated microgravity.
25229347 2014 5-Lipoxygenase inhibitors attenuate TNF-?-induced inflammation in human synovial fibroblasts.
25218842 2014 Identification and molecular characterization of a novel splice variant of human 5- lipoxygenase gene.
25193960 2014 Low leukotriene B4 receptor 1 leads to ALOX5 downregulation at diagnosis of chronic myeloid leukemia.
24860872 2014 Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS.
24746852 2014 Human cytomegalovirus infection induces leukotriene B4 and 5-lipoxygenase expression in human placentae and umbilical vein endothelial cells.
24662827 2015 Increased metabolites of 5-lipoxygenase from hypoxic ovarian cancer cells promote tumor-associated macrophage infiltration.
24480307 2014 A mutation interfering with 5-lipoxygenase domain interaction leads to increased enzyme activity.
24350867 2014 5-Lipoxygenase and cysteinyl leukotriene receptor 1 regulate epidermal growth factor-induced cell migration through Tiam1 upregulation and Rac1 activation.
24335295 2014 The Kaposi's sarcoma-associated herpesvirus (KSHV)-induced 5-lipoxygenase-leukotriene B4 cascade plays key roles in KSHV latency, monocyte recruitment, and lipogenesis.
24226420 2014 Critical role of 5-lipoxygenase and heme oxygenase-1 in wound healing.
24130502 2013 Cooperation between RUNX1-ETO9a and novel transcriptional partner KLF6 in upregulation of Alox5 in acute myeloid leukemia.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24036216 2013 5-Lipoxygenase contributes to PPAR? activation in macrophages in response to apoptotic cells.
24005813 2013 Association of polymorphisms in FLT3, EGFR, ALOX5, and NEIL3 with glioblastoma in the Han Chinese population.
23828562 2013 Lack of effect of common single nucleotide polymorphisms in leukotriene pathway genes on platelet reactivity in patients with diabetes.
23752617 2013 5-lipoxygenase antagonist therapy: a new approach towards targeted cancer chemotherapy.
23746795 2013 Association of ALOX5AP1 SG13S114T/A variant with ischemic stroke, stroke subtypes and aspirin resistance.
23727898 2013 Involvement of 5-lipoxygenase in Alzheimer's disease: a role for DNA methylation.
23720274 2013 5-Lipoxygenase plays a pivotal role in endothelial adhesion of monocytes via an increased expression of Mac-1.
23642263 2013 Mass spectrometry-based proteomics identifies UPF1 as a critical gene expression regulator in MonoMac 6 cells.
23600541 2013 ALOX5 polymorphism associates with increased leukotriene production and reduced lung function and asthma control in children with poorly controlled asthma.
23572152 2013 The change of LTB4 and 5-LO during pregnancy.
23485709 2013 Volume-sensitive release of organic osmolytes in the human lung epithelial cell line A549: role of the 5-lipoxygenase.
23448388 2013 ALOX5 is associated with tuberculosis in a subset of the pediatric population of North China.
23351835 2013 Adipose tissue arachidonic acid content is associated with the expression of 5-lipoxygenase in atherosclerotic plaques.
23332172 2013 5-Lipoxygenase pharmacological blockade decreases tau phosphorylation in vivo: involvement of the cyclin-dependent kinase-5.
23179791 2013 Role of LOXs and COX-2 on FAK activation and cell migration induced by linoleic acid in MDA-MB-231 breast cancer cells.
23079635 2013 Differential contribution of lipoxygenase isozymes to nigrostriatal vulnerability.
23079278 2012 Genetic variation in members of the leukotrienes biosynthesis pathway confers risk of ischemic stroke in Eastern Han Chinese.
23067353 2012 Association of Sp1 tandem repeat polymorphism of ALOX5 with coronary artery disease in Indian subjects.
22825379 2012 Human 5-, 12- and 15-lipoxygenase-1 coexist in kidney but show opposite trends and their balance changes in cancer.
22808264 2012 The functional interaction between Acyl-CoA synthetase 4, 5-lipooxygenase and cyclooxygenase-2 controls tumor growth: a novel therapeutic target.
22739369 2012 Arachidonate 5-lipoxygenase gene variants affect response to fish oil supplementation by healthy African Americans.
22690932 2012 Increased expression of the 5-lipoxygenase pathway and its cellular localization in Barrett's adenocarcinoma.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22616993 2012 Epigenetic regulation of 5-lipoxygenase in the phenotypic plasticity of valvular interstitial cells associated with aortic valve stenosis.
22516296 2012 Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.
22433003 2012 Licofelone inhibits interleukin-18-induced pro-inflammatory cytokine release and cellular proliferation in human mesangial cells.
22363630 2012 Post-transcriptional regulation of 5-lipoxygenase mRNA expression via alternative splicing and nonsense-mediated mRNA decay.
22293202 2012 Lipid metabolism enzyme 5-LOX and its metabolite LTB4 are capable of activating transcription factor NF-?B in hepatoma cells.
22282663 2012 Ovarian cancer risk associated with inherited inflammation-related variants.
22253131 2012 Arachidonate 5 lipoxygenase expression in papillary thyroid carcinoma promotes invasion via MMP-9 induction.
22050225 2011 Dimerization of human 5-lipoxygenase.
21883892 2012 Trichostatin A induces 5-lipoxygenase promoter activity and mRNA expression via inhibition of histone deacetylase 2 and 3.
21729626 2011 [Association of leukotriene gene polymorphisms with response to antileukotriene treatment in patients with asthma].
21723968 2011 Two dimensional difference gel electrophoresis analysis of cerebrospinal fluid in tuberculous meningitis patients.
21605700 Increased ?5- and ?6-desaturase, cyclooxygenase-2, and lipoxygenase-5 expression and activity are associated with fatty acid and eicosanoid changes in cystic fibrosis.
21540635 2011 Polymorphisms in genes involved in innate immunity and susceptibility to benzene-induced hematotoxicity.
21482803 2011 Biosynthesis of hemiketal eicosanoids by cross-over of the 5-lipoxygenase and cyclooxygenase-2 pathways.
21403093 2011 Upregulation of the 5-lipoxygenase pathway in human aortic valves correlates with severity of stenosis and leads to leukotriene-induced effects on valvular myofibroblasts.
21314617 2010 Interaction of ceruloplasmin and 5-lipoxygenase.
21296957 2011 ALOX5 gene variants affect eicosanoid production and response to fish oil supplementation.
21233389 2011 The structure of human 5-lipoxygenase.
21224059 2011 Arachidonate 5-lipoxygenase establishes adaptive humoral immunity by controlling primary B cells and their cognate T-cell help.
21200133 2011 Ligation of CD40 receptor in human B lymphocytes triggers the 5-lipoxygenase pathway to produce reactive oxygen species and activate p38 MAPK.
21098726 2011 Novel 5-lipoxygenase isoforms affect the biosynthesis of 5-lipoxygenase products.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20592751 2010 Human lipoxygenase pathway gene variation and association with markers of subclinical atherosclerosis in the diabetes heart study.
20549218 2010 Overexpression of 5-lipoxygenase in sporadic colonic adenomas and a possible new aspect of colon carcinogenesis.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20388081 2010 A pilot study on prostate cancer risk and pro-inflammatory genotypes: pathophysiology and therapeutic implications.
20382140 2010 mRNA levels of enzymes and receptors implicated in arachidonic acid metabolism in gliomas.
20372792 2010 Cyclooxygenase-2 and 5-lipoxygenase pathways in diosgenin-induced apoptosis in HT-29 and HCT-116 colon cancer cells.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20173757 2010 A mutant of HBx (HBxDelta127) promotes hepatoma cell growth via sterol regulatory element binding protein 1c involving 5-lipoxygenase.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20128419 2009 5-Lipoxygenase pathway gene polymorphisms: lack of association with asthma in a Spanish population.
20126469 2010 A mutant of hepatitis B virus X protein (HBxDelta127) promotes cell growth through a positive feedback loop involving 5-lipoxygenase and fatty acid synthase.
20110601 2010 Role of cyclooxygenase-2 and 5-lipoxygenase polymorphisms in Alzheimer's disease in a population from northern Italy: implication for pharmacogenomics.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19919819 5-lipoxygenase pathway promotes cell proliferation in human glioma cell lines.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19888660 2009 Genetic determinants of serum lipid levels in Chinese subjects: a population-based study in Shanghai, China.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19807693 2009 Coactosin-like protein functions as a stabilizing chaperone for 5-lipoxygenase: role of tryptophan 102.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
19717473 2009 Functional analysis of 5-lipoxygenase promoter repeat variants.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19524426 2009 Leukotriene pathway polymorphisms are associated with altered cysteinyl leukotriene production in children with acute asthma.
19497113 2009 Expression of 5-lipoxygenase and 15-lipoxygenase in rheumatoid arthritis synovium and effects of intraarticular glucocorticoids.
19473080 2009 Genotyping the GGGCGG tandem repeat promoter polymorphism in the 5-lipoxygenase enzyme gene (ALOX5) by pyrosequencing assay.
19450127 2009 Asthma pharmacogenetic study using finite mixture models to handle drug-response heterogeneity.
19446447 Functional variants of the human 5-lipoxygenase gene and their genetic diagnosis.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19390118 2009 5-Lipoxygenase-mediated endogenous DNA damage.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19233132 2009 Distinct parts of leukotriene C(4) synthase interact with 5-lipoxygenase and 5-lipoxygenase activating protein.
19224689 2009 [Protein expression of 5-lipoxygenase and activation and cytotoxicity of Benzidine in human bronchial epithelial cells].
19214143 2009 5-lipoxygenase pharmacogenetics in asthma: overlap with Cys-leukotriene receptor antagonist loci.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19134178 2009 High expression of 5-lipoxygenase in normal and malignant mantle zone B lymphocytes.
19131661 2009 Genetic variation in the leukotriene pathway and carotid intima-media thickness: a 2-stage replication study.
19130089 2009 Genetic effects in the leukotriene biosynthesis pathway and association with atherosclerosis.
19083497 2008 Grape seed and red wine polyphenol extracts inhibit cellular cholesterol uptake, cell proliferation, and 5-lipoxygenase activity.
19075240 2008 The nuclear membrane organization of leukotriene synthesis.
19053751 2008 Pirinixic acid derivatives as novel dual inhibitors of microsomal prostaglandin E2 synthase-1 and 5-lipoxygenase.
19022417 2009 Human Dicer C-terminus functions as a 5-lipoxygenase binding domain.
18996667 2008 The development of methodology for clinical measurement of 5-lipoxygenase pathway intermediates from human peripheral blood mononuclear cells.
18992148 2008 Low-penetrance alleles predisposing to sporadic colorectal cancers: a French case-controlled genetic association study.
18991687 2008 Pro-inflammatory gene variants in myocardial infarction and longevity: implications for pharmacogenomics.
18978352 2009 Phosphorylation of serine 271 on 5-lipoxygenase and its role in nuclear export.
18976020 2008 Correlative study of microvessel density and 5-lipoxygenase expression in human sporadic colorectal cancer.
18927292 2008 Overexpression of 5-lipoxygenase in colon polyps and cancer and the effect of 5-LOX inhibitors in vitro and in a murine model.
18843019 2008 5-lipoxygenase and 5-lipoxygenase-activating protein gene polymorphisms, dietary linoleic acid, and risk for breast cancer.
18842779 2008 Nutrigenetic association of the 5-lipoxygenase gene with myocardial infarction.
18678882 2008 Increased 5-lipoxygenase immunoreactivity in the hippocampus of patients with Alzheimer's disease.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18571838 2008 The long-term effect of Helicobacter pylori eradication on COX-1/2, 5-LOX and leukotriene receptors in patients with a risk gastritis phenotype--a link to gastric carcinogenesis.
18525291 The Sp1/Egr1-tandem repeat polymorphism in the 5-lipoxygenase gene promoter is not associated with late onset Alzheimer disease.
18421434 2008 Identification of ALOX5 as a gene regulating adiposity and pancreatic function.
18421027 2008 Lipoxygenase pathway receptor expression in ovarian cancer.
18398223 2008 Candidate genes of the 5-lipoxygenase pathway in acute coronary syndrome: a pilot study.
18369664 2008 Common polymorphisms of ALOX5 and ALOX5AP and risk of coronary artery disease.
18366797 2008 Influence of leukotriene gene polymorphisms on chronic rhinosinusitis.
18339529 2008 ALOX5 promoter genotype and response to montelukast in moderate persistent asthma.
18295198 2008 A rat air pouch model for evaluating the efficacy and selectivity of 5-lipoxygenase inhibitors.
18280718 2008 Cyclooxygenase (COX) and 5-lipoxygenase (5-LOX) selectivity of COX inhibitors.
18218859 2008 The role of diacylglyceride generation by phospholipase D and phosphatidic acid phosphatase in the activation of 5-lipoxygenase in polymorphonuclear leukocytes.
18204779 2008 A novel polymorphism, E254K, in the 5-lipoxygenase gene associated with bronchial asthma.
18180307 2008 Human CMV infection induces 5-lipoxygenase expression and leukotriene B4 production in vascular smooth muscle cells.
18179798 2008 Arachidonate 5-lipoxygenase (5-LO) promoter genotype and risk of myocardial infarction: a case-control study.
18174194 2008 ALOX5 variants associated with susceptibility to human pulmonary tuberculosis.
17924829 2007 CysLTR1 promoter polymorphism and requirement for leukotriene receptor antagonist in aspirin-intolerant asthma patients.
17909879 2008 Association studies of ALOX5 and bone mineral density in healthy adults.
17894944 2007 The histone deacetylase inhibitor trichostatin A mediates upregulation of 5-lipoxygenase promoter activity by recruitment of Sp1 to distinct GC-boxes.
17825794 2007 Expanding expression of the 5-lipoxygenase/leukotriene B4 pathway in atherosclerotic lesions of diabetic patients promotes plaque instability.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17616938 2007 Increased expression of 5-lipoxygenase is common in clear cell renal cell carcinoma.
17521309 2007 Interaction of genetic risk factors confers higher risk for thrombotic stroke in male Chinese: a multicenter case-control study.
17500032 2007 Functional characterization of vitamin D responding regions in the human 5-Lipoxygenase gene.
17467166 2007 Involvement of 5-lipoxygenase in survival of Epstein-Barr virus (EBV)-converted B lymphoma cells.
17460547 2007 Pharmacogenetics of the 5-lipoxygenase biosynthetic pathway and variable clinical response to montelukast.
17434678 2007 Suppression of 5-lipoxygenase gene is involved in triptolide-induced apoptosis in pancreatic tumor cell lines.
17373938 2007 A functional Sp1/Egr1-tandem repeat polymorphism in the 5-lipoxygenase gene is not associated with myocardial infarction.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
17236225 2007 Common polymorphisms in 5-lipoxygenase and 12-lipoxygenase genes and the risk of incident, sporadic colorectal adenoma.
17115186 2007 TagSNP evaluation for the association of 42 inflammation loci and vascular disease: evidence of IL6, FGB, ALOX5, NFKBIA, and IL4R loci effects.
17080223 2006 Platelet-induced growth of human fibroblasts is associated with an increased expression of 5-lipoxygenase.
17072961 2006 Expression of 5-lipoxygenase in human colorectal cancer.
17018618 2006 Distinct effects of annexin A7 and p53 on arachidonate lipoxygenation in prostate cancer cells involve 5-lipoxygenase transcription.
16924104 2006 Coactosin-like protein supports 5-lipoxygenase enzyme activity and up-regulates leukotriene A4 production.
16919603 2006 The coding sequence mediates induction of 5-lipoxygenase expression by Smads3/4.
16899822 2006 Dihydroxydocosahexaenoic acids of the neuroprotectin D family: synthesis, structure, and inhibition of human 5-lipoxygenase.
16750418 2006 Analysis of the 5-lipoxygenase promoter and characterization of a vitamin D receptor binding site.
16733792 2005 Expression of 5-lipoxygenase in specialized epithelial cells of nasopharyngeal-associated lymphoid tissue.
16698924 2006 Expression of 5-lipoxygenase and leukotriene A4 hydrolase in human atherosclerotic lesions correlates with symptoms of plaque instability.
16672272 2006 Binding investigation of human 5-lipoxygenase with its inhibitors by SPR technology correlating with molecular docking simulation.
16537708 2006 Prostacyclin synthase and arachidonate 5-lipoxygenase polymorphisms and risk of colorectal polyps.
16531984 2006 N-3 PUFAs reduce oxidative stress in ESRD patients on maintenance HD by inhibiting 5-lipoxygenase activity.
16495221 2006 Effect of arachidonic acid reacylation on leukotriene biosynthesis in human neutrophils stimulated with granulocyte-macrophage colony-stimulating factor and formyl-methionyl-leucyl-phenylalanine.
16413224 2005 GC-rich sequences in the 5-lipoxygenase gene promoter are required for expression in Mono Mac 6 cells, characterization of a novel Sp1 binding site.
16402861 Inhibitory effects of mizolastine on ultraviolet B-induced leukotriene B4 production and 5-lipoxygenase expression in normal human dermal fibroblasts in vitro.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16364163 2006 ALOX5 promoter genotype, asthma severity and LTC production by eosinophils.
16361798 2005 Leukotriene-related gene polymorphisms in patients with aspirin-intolerant urticaria and aspirin-intolerant asthma: differing contributions of ALOX5 polymorphism in Korean population.
16293801 2006 Influence of leukotriene pathway polymorphisms on response to montelukast in asthma.
16275640 2006 Arachidonic acid regulates the translocation of 5-lipoxygenase to the nuclear membranes in human neutrophils.
16165096 2005 Stress-induced nuclear export of 5-lipoxygenase.
16135563 2005 Caspase-mediated degradation of human 5-lipoxygenase in B lymphocytic cells.
15933245 2005 Association between 5-lipoxygenase expression and plaque instability in humans.
15923196 2005 1-Oleoyl-2-acetylglycerol stimulates 5-lipoxygenase activity via a putative (phospho)lipid binding site within the N-terminal C2-like domain.
15848143 2005 Mutation analysis of the human 5-lipoxygenase C-terminus: support for a stabilizing C-terminal loop.
15661803 2005 Increased 5-lipoxygenase expression and induction of apoptosis by its inhibitors in esophageal cancer: a potential target for prevention.
15616590 2005 5-Lipoxygenase regulates senescence-like growth arrest by promoting ROS-dependent p53 activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308583 2004 Arachidonate lipoxygenase (ALOX) and cyclooxygenase (COX) polymorphisms and colon cancer risk.
15301234 The expression of cyclooxygenase-1, cyclooxygenase-2 and 5-lipoxygenase in inflammatory muscle tissue of patients with polymyositis and dermatomyositis.
15280375 2004 Protein kinase A inhibits leukotriene synthesis by phosphorylation of 5-lipoxygenase on serine 523.
15219851 2004 Characterization of calcium and magnesium binding domains of human 5-lipoxygenase.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15010818 2004 Expression of lipoxygenase in human prostate cancer and growth reduction by its inhibitors.
14767568 2004 Relationship between lipoxygenase and human testicular cancer.
14749922 2004 Leukotriene-related gene polymorphisms in ASA-intolerant asthma: an association with a haplotype of 5-lipoxygenase.
14702425 2004 Arachidonate 5-lipoxygenase promoter genotype, dietary arachidonic acid, and atherosclerosis.
14532840 2003 Expression of lipoxygenase in human bladder carcinoma and growth inhibition by its inhibitors.
12911785 2003 Promoter polymorphism in the 5-lipoxygenase (ALOX5) and 5-lipoxygenase-activating protein (ALOX5AP) genes and asthma susceptibility in a Caucasian population.
12907138 2003 Levels of expression of lipoxygenases and cyclooxygenase-2 in human breast cancer.
12893830 2003 The C2-like beta-barrel domain mediates the Ca2+-dependent resistance of 5-lipoxygenase activity against inhibition by glutathione peroxidase-1.
12859962 2003 Inhibition of arachidonate 5-lipoxygenase triggers prostate cancer cell death through rapid activation of c-Jun N-terminal kinase.
12751769 2003 Increased expression of 5-lipoxygenase in glioblastoma multiforme.
12751768 2003 The leukotriene receptor CysLT1 and 5-lipoxygenase are upregulated in colon cancer.
12751728 2003 LTC4 production by eosinophils in asthmatic subjects with alternative forms of ALOX-5 core promoter.
12730086 2003 Amino acid differences in the deduced 5-lipoxygenase sequence of CAST atherosclerosis-resistance mice confer impaired activity when introduced into the human ortholog.
12695552 2003 Platelets abrogate leukotriene B(4) generation by human blood neutrophils stimulated with monosodium urate monohydrate or f-Met-Leu-Phe in vitro.
12664574 2002 Calcium binding to 5-lipoxygenase.
12629151 2003 Toxicity of human monocytic THP-1 cells and microglia toward SH-SY5Y neuroblastoma cells is reduced by inhibitors of 5-lipoxygenase and its activating protein FLAP.
12525578 2003 Cell type-dependent activation of 5-lipoxygenase by arachidonic acid.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234060 2002 Expression of 5-lipoxygenase mRNA is unchanged in the colon of patients with active inflammatory bowel disease.
12163367 2002 5-Lipoxygenase and leukotriene B(4) receptor are expressed in human pancreatic cancers but not in pancreatic ducts in normal tissue.
12140292 2002 Structural and functional criteria reveal a new nuclear import sequence on the 5-lipoxygenase protein.
12111389 2002 Structural characterization of the catalytic domain of the human 5-lipoxygenase enzyme.
12107604 2002 5-Lipoxygenase polymorphism and in-vivo response to leukotriene receptor antagonists.
12021253 2002 Transcellular biosynthesis contributes to the production of leukotrienes during inflammatory responses in vivo.
11844797 2002 Arachidonic acid promotes phosphorylation of 5-lipoxygenase at Ser-271 by MAPK-activated protein kinase 2 (MK2).
11471199 2001 Predictive genetic testing -- new possibilities in determination of risk of complex diseases.
11462800 2001 Neurogenesis and neuroprotection in the adult brain. A putative role for 5-lipoxygenase?
11297527 2001 5-Lipoxygenase interacts with coactosin-like protein.
10779545 2000 5-lipoxygenase is phosphorylated by p38 kinase-dependent MAPKAP kinases.
10673219 2000 The molecular biology and regulation of 5-lipoxygenase.
10514459 1999 Identification of a bipartite nuclear localization sequence necessary for nuclear import of 5-lipoxygenase.
10051563 1999 Interaction of 5-lipoxygenase with cellular proteins.
9445303 1998 5-Lipoxygenase and 5-lipoxygenase activating protein (FLAP) immunoreactivity in lungs from patients with primary pulmonary hypertension.
9435249 1998 5-Lipoxygenase expression in Langerhans cells of normal human epidermis.
9150468 1997 Contrasting effects of proinflammatory and T-helper lymphocyte subset-2 cytokines on the 5-lipoxygenase pathway in monocytes.
9079648 1997 Rapid import of cytosolic 5-lipoxygenase into the nucleus of neutrophils after in vivo recruitment and in vitro adherence.
8585605 1995 Competitive binding assay of src homology domain 3 interactions between 5-lipoxygenase and growth factor receptor binding protein 2.
8268460 1993 5-Lipoxygenase activity in the human pancreas.
8245774 1993 5-lipoxygenase and 5-lipoxygenase-activating protein are localized in the nuclear envelope of activated human leukocytes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8066098 1994 Cyclooxygenase gene expression in human endometrium and decidua.
7929073 1994 5-Lipoxygenase contains a functional Src homology 3-binding motif that interacts with the Src homology 3 domain of Grb2 and cytoskeletal proteins.
7624354 1995 Expression of 5-lipoxygenase in differentiating human skin keratinocytes.
7556168 1995 Studies on the regulation and localization of 5-lipoxygenase in human B-lymphocytes.
3422434 1988 Cloning of the cDNA for human 5-lipoxygenase.
3134355 1988 Translocation of 5-lipoxygenase to the membrane in human leukocytes challenged with ionophore A23187.
3118366 1987 Reversible, calcium-dependent membrane association of human leukocyte 5-lipoxygenase.
2829172 1988 Molecular cloning and amino acid sequence of human 5-lipoxygenase.
2565035 1989 Characterization of the human 5-lipoxygenase gene.
2526519 1989 Molecular cloning and amino acid sequence of human 5-lipoxygenase.
2251250 1990 Characterization of the human 5-lipoxygenase gene promoter.
1939225 1991 Evaluation of the role of conserved His and Met residues among lipoxygenases by site-directed mutagenesis of recombinant human 5-lipoxygenase.
1540191 1992 Mutagenesis studies on the amino acid residues involved in the iron-binding and the activity of human 5-lipoxygenase.