Property Summary

NCBI Gene PubMed Count 169
PubMed Score 256.00
PubTator Score 537.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Actinic keratosis 22
Disease Target Count P-value
ovarian cancer 8491 4.3e-10
uncontrolled asthma 67 6.0e-03
osteosarcoma 7933 7.2e-03
Disease Target Count Z-score Confidence
Cancer 2346 3.709 1.9
Asthma 349 3.058 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
uncontrolled asthma 1.100 6.0e-03
osteosarcoma -1.226 7.2e-03
ovarian cancer -1.900 4.3e-10

Protein-protein Interaction (2)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
887 confirmatory 1054 / 3789 / 69447 qHTS Assay for Inhibitors of 15-hLO (15-human lipoxygenase)
2155 confirmatory 20 / 0 / 0 Cuvette-Based Assay fo Inhibitors of 15-hLO-1 (15-human lipoxygenase 1): Series 1 - Round 1
2157 confirmatory 12 / 15 / 27 Confirmation qHTS Assay for Inhibitors of 15-hLO (15-human lipoxygenase)
2169 summary 0 / 0 / 0 Probe Development Summary of Inhibitors of 15-hLO-1 (15-human lipoxygenase 1)
493219 confirmatory 0 / 0 / 60 Inhibitors of 12-hLO (12-human lipoxygenase): 15hLO-1 Cuvette-Based Activation Counterscreen Assay for 12hLO Followup Compounds
493220 confirmatory 45 / 2 / 13 Inhibitors of 12-hLO (12-human lipoxygenase): 15hLO-1 Cuvette-Based Inhibition Counterscreen Assay for 12hLO Followup Compounds

Gene RIF (151)

PMID Text
26871724 Hypoxia increase the production of ROS through the 15-Lipoxygenase/15-Hydroxyeicosatetraenoiccid pathway.
26646740 The molecular origin of substrate specificity of 15-LOX-1 for linoleic acid in comparison with arachidonic acid has been analyzed.
26276392 limiting ALOX15 expression by AMPK may promote an anti-inflammatory phenotype of IL-4-stimulated human macrophages
26194111 The role of 15-LOX-1 in colitis and colitis-associated colorectal cancer
26067486 Significant associations with NSAID-exacerbated respiratory disease were identified for: ALOX15 homozygous genotype and PTGS-1 rs5789 A/A homozygous genotype
26036173 variation in inflammation related genes ALOX15 and IL6 was associated with bone microarchitecture and density in young adult women, but appears to be less important in the elderly
25708815 The 12/15-lipoxygenase as an emerging therapeutic target for Alzheimer's disease
25576922 Effect of 12/15-LOX on colorectal tumorigenesis in mouse models could be affected by tumor cell type (human or mouse), relative 12/15 LOX activity in tumor cells and stroma as well as the relative tumor 13-HODE and 12-HETE levels.
25549319 IGF-1 reduces lipid oxidation and foam cell formation via downregulation of 12/15-LOX to prevent atherosclerosis.
25105362 Loss of Alox15 altered expression of PTEN, PI3K/AKT, and the transcription factor ICSBP
24955608 ALOX 12 may have a critical role in regulation of inflammation in visceral adipose tissue in obesity and type 2 diabetes.
24742828 Positive ALOX15 expression is more prevalent in eosinophilic esophagitis than in gastroesophageal reflux disease
24668884 enzymatic activity and the intracellular membrane-binding function of 15-LO1 appear to contribute to HIF-1alpha suppression
24634093 These findings demonstrate that 15-LOX-1 expression loss in cancer cells promotes metastasis and that therapeutically targeting ubiquitous 15-LOX-1 loss in cancer cells has the potential to suppress metastasis.
24465480 results demonstrate that UTX is implicated in IL-4 mediated transcriptional activation of the ALOX15 gene
23958500 The conserved glycine is of functional importance for ALOX15 enzyme variants; most mutants at this position lose catalytic activity.
23872364 h15-LO-1-derived metabolites are highly vasoactive and may play a critical role in regulating coronary blood flow
23844124 Data indicate a strong negative correlation between ALOX15, FADS2, and IL5RA expression with 2-arachidonoylglycerophosphocholine levels in dual asthmatic responses.
23838566 Our data support a role for 12/15-LOX activation as an inflammatory mediator of injury in periventricular leukomalacia
23828562 The results of our study failed to confirm whether the selected variants in ALOX15 gene within the LT metabolism pathway contribute to platelet reactivity in a diabetic population treated with ASA.
23528921 Findings suggest 12/15-LOX expressed in non-epithelial cells such as macrophages and fibroblasts leads to bronchial epithelial injury.
23474367 15-LO-1/15-HETE pathway prevents hepatocellular carcinoma cells from apoptosis and promotes hepatocellular carcinoma progression via a specific intracellular signaling pathway centered by the interaction of Akt with heat shock protein 90
23404351 Genetic variability in FLAP and ALOX15 may modify the protective effect of NSAID use against colorectal neoplasia.
23285160 histone methylation/demethylation at the 15-LOX-1 promoter is important in the transcriptional regulation of the gene in cultured cells.
23249676 Evidence suggests that up-regulation of 15-LO in vascular endothelium results in increased synthesis of arachidonic acid metabolites, increased membrane hyperpolarization, and enhanced contribution to relaxation by endothelial agonists. [REVIEW]
23181793 Genetic variant may play a role in NSAID induced acute urticaria.
23079635 In transgenic knock-out 12/15-LOX mice, there is a reduction in dopamine striatal levels following neurotoxicant challenge compared to wild-type.
23066085 findings demonstrate that 15-LOX-1-mediated metabolism of DHA is required for it to upregulate SDC-1 and trigger the signaling pathway that elicits apoptosis in prostate cancer cells
22960430 COX-2 promotes while 15-LOX-1 inhibits colonic tumorigenesis (Review).
22879973 This study suggests that vimentin binds the ALOX15 promoter and regulates its promoter activity and protein expression
22825379 increased 15-LOX-1 and decreased 5- and 12-LOX levels at the onset of kidney cancer reversing with the progressing stage of the disease or the grade of tumor
22750246 increased ALOX15 in human ischemic heart biopsies was demonstrated.
22652554 promoter polymorphisms of the ALOX15 gene affect ALOX15 activity leading to increased eosinophil infiltration in aspirin-exacerbated respiratory disease
22516296 phosphorylation of 5-LOX at S663 not only down-regulates leukotriene synthesis but also stimulates lipoxin production in inflammatory cells that do not express 15-LOX, redirecting lipid mediator biosynthesis to the production of mediators of inflammation.
22472308 Mice with human 15-LOX-1 expression in colonic epithelial cells were less susceptible than wild-type mice to AOM-induced colonic tumorigenesis. 15-LOX-1 appears to act as a tumor suppressor and an inhibitor of TNF-alpha-iNOS signaling and NF-kappaB activation.
22351111 The rs7217186 and rs2619112 polymorphisms of the ALOX15 gene are associated with ischemic stroke in males and in patients with atherosclerosis in northern Chinese Han population.
22301860 rs916055 in ALOX15 gene was significantly associated with the percentage of fat mass in Chinese nuclear families with male offspring in the family-based association study using quantitative transmission disequilibrium test approach.
22275252 12/15-lipoxygenase-overexpressing transgenic mice have elevated levels of BACE1, whereas 12/15-LO-deficient mice have reduced levels.
22210710 Results support the pro-apoptotic role of 15-lipoxygenase-1 and suggest that 15-lipoxygenase-1 could be a potential new target gene for the therapy of malignant glioma.
22094113 STAT6 activation and chromatin remodeling by DNA demethylation and histone acetylation are crucial for transcriptional activation of 15-LOX-1 in cultured Hodgkin lymphoma cells.
22089472 The results suggest that the genetic polymorphisms in both human ALOX12 and ALOX15 may contribute to variations in the peak BMD of Chinese women.
22078795 Data indicate that expressions of 15-LO-1 and 15-LO-2 in placentas and umbilical artery (HUA) rings in preeclampsia (PE) increased more than that in normal groups.
22037943 15-LOX-1 promotes various anti-tumorigenic events, including cell differentiation and apoptosis, and inhibits chronic inflammation, angiogenesis, and metastasis. [review]
21881028 15-lipoxygenase-1 expression loss is associated with cancer cells to terminal cell differentiation evasion.
21831839 Colocalization of Raf-1 to PEBP1 is low in asthmatic tissue and cells compared with normals, whereas there is striking colocalization of 15LO1 with PEBP1 in asthma.
21771656 cPLA(2)alpha gene activation by IL-1beta is dependent on an upstream kinase pathway, enzymatic activation and downstream 15-lipoxygenase activity: a positive feedback loop
21558275 Molecular basis for the reduced catalytic activity of the naturally occurring T560M mutant of human 12/15-lipoxygenase that has been implicated in coronary artery disease.
21544861 15-lipoxygenase-1 exerts its tumor suppressive role by inhibiting nuclear factor-kappa B via activation of PPAR gamma
21094135 the 12 and 15 ALOX expression, localization and downstream cytokine expression in subcutaneous and omental adipose tissue in human obesity were shown.
20861348 These studies characterize an important regulatory role for ERK1/2 in mediating IL-13-induced monocyte 15-LO expression via the transcription factors Egr-1 and CREB
20676957 ALOX15 SNPs are associated with increased risk of coronary artery disease in a Chinese Han population.
20676957 Observational study of gene-disease association. (HuGE Navigator)
20668019 White tea extract induces apoptosis via PPAR gamma and 15-lipoxygenases.
20649594 Induction of 15-LOX-1-mediated down-regulation of a PPAR-gamma and COX-2 pathway by honokiol may be a promising therapeutic strategy for gastric cancer.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20592751 Observational study of gene-disease association. (HuGE Navigator)
20570249 Genetic absence of this enzyme results in a significant reduction in amyloid-beta (Abeta) production and deposition and an improvement of cognitive deficits.
20485444 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20382140 The mRNA levels of ALOX15 implicated pathways differed significantly in gliomas according to the histological type.
20308035 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19942621 Genetic variations in LEP, CAPNS1 and ALOX15 show significant association with IL-6 expression.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19775287 expression of 15-LO-1 significantly decreased cell proliferation and increased apoptosis.
19752603 Up-regulation of 15-LOX-1 alone may possibly be sufficient to treat colorectal cancer; further studies are awaited.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19663136 The genetic effects of ALOX12 and ALOX15 polymorphisms for developing aspirin-exacerbated respiratory disease may be minimal compared with those of ALOX5.
19663136 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19576981 The 15-lipoxygenase-mediated formation of 15(S)-HpETE was in the forms of free fatty acid and esterified lipids, which was subsequently converted to 4-oxo-2(E)-nonenal.
19568414 omega-3 fatty acids slow prostate cancer growth by altering omega-6/omega-3 ratios through diet and by promoting apoptosis and inhibiting proliferation in tumors by directly competing with omega-6 fatty acids for 15-LO-1 and COX-2 activities.
19528634 The 15-LO-1 is present and functional on cytoplasmic neutral lipid droplets in macrophage foam cells, and these droplets may act to accumulate the anti-inflammatory lipid mediator 15(S)-HETE.
19497113 A detailed study of 15-LO-1 enzyme expression in rheumatoid arthritis synovium (RA) shows that it is highly expressed in the synovial lining, and that its expression overall is significantly lower in osteoarthritis synovium compared with RA.
19481615 The reaction specificities of wild-type vertebrate lipoxygenase isoforms are largely resistant towards pH alterations.
19469483 The mechanism and kinetics of the oxydation of arachidonic acid by both 15-lipoxygenase and 12-lipoxygenase was studied using recombinant enzymes.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19429775 An increased expression and activity of 15-LOX-1 in lung epithelial cells is a proinflammatory event in the pathogenesis of asthma and other inflammatory lung disorders.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19325142 Overexpression of human 15(S)-lipoxygenase-1 in RAW macrophages leads to increased cholesterol mobilization and reverse cholesterol transport.
19296842 15-lipoxygenases may have chondroprotective properties by reducing MMP-1 and MMP-13 expression.
19198625 NuRD contributes to 15-LOX-1 transcription suppression in colon cancer cells
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19131661 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19131063 ALOX15 may play a less prominent role during later stages of atherosclerosis involving atherothrombotic mechanisms than eventually during early plaque development
19131063 Observational study of gene-disease association. (HuGE Navigator)
19130894 putative role in airway inflammatory disease (i.e., asthma, COPD) and Hodgkin lymphoma--REVIEW
19089921 15-LOX-2 suppresses VEGF gene expression and sustains tumor dormancy in prostate cancer
19046748 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18799463 histone modification in the 15-LOX-1 promoter is important to 15-LOX-1 transcriptional silencing in colon cancer cells
18785202 The 15-LOX-1 protein binds to DNA-PK, increasing its kinase activity and results in downstream activation of the tumor suppressor p53, thus revealing a new mechanism by which lipoxygenases (LOX) may influence the phenotype of tumor cells.
18774388 association study found the 15-lipoxygenase (15-LO) associations with airway hyperresponsiveness and allergic asthma significant in 2 Canadian samples
18774388 Observational study of gene-disease association. (HuGE Navigator)
18755188 The effects of UV on 12/15-LOX gene expression in the human keratinocyte cell line, HaCaT, were studied.
18692814 ALOX15 -292 C/T functional polymorphism was not correlated either with the risk of developing an endometriosis or with the risk of infertility.
18692814 Observational study of gene-disease association. (HuGE Navigator)
18684974 Modification with 15-lipoxygenase significantly impairs the ability of high density lipoprotein (HDL)3 to contrast the effect of a proinflammatory stimulus on endothelial cells.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18647347 The Hodgkin lymphoma-derived cell line L1236 has high expression of 15-lipoxygenase-1 and that these cells readily convert arachidonic acid to eoxin C(4), eoxin D(4) and eoxin E(4).
18547056 Kinetic isotope effects (KIEs) in the reactions of three human LOs (platelet 12-hLO, reticulocyte 15-hLO-1, and epithelial 15-hLO-2) with arachidonic acid (AA).
18392641 ALOX15 single nucleotide polymorphisms (SNPs)have a possible role in focal atherosclerosis plaque formation.
18392641 Observational study of gene-disease association. (HuGE Navigator)
18239141 REVIEW: inhibitory effect of 15-LO-1 on VEGF- or PlGF-induced angiogenesis
18227726 study demonstrated increased 15-LO-1 protein, mRNA, and enzyme activity, respectively, in normal human bladder tissues in comparison with stage T3/T4 human bladder tumors
18198215 DNMT-1 has a direct suppressive role in 15-LOX-1 transcriptional silencing that is independent of 15-LOX-1 promoter DNA methylation
18187376 These results demonstrate a novel mechanism of parathyroid hormone-induced human bone cell proliferation operating through 12- and 15-lipoxygenase enzymes.
18180398 Increased expression of 15-lipoxygenase-1 increases acetylcholine relaxation in arteries and hypotensive responses in rabbits because of increased hydroxy-epoxyeicosatrienoic acid and trihydroxyeicosatrienoic acid synthesis.
18090132 15-lipoxygenase-2 mRNA is strongly augmented during ovarian carcinogenesis and that the enzyme may constitute a suitable candidate as a tumor marker.
18067895 increased expression of 15-LOX-2 induced by hypoxia may participate in T cell recruitment in diseases such as atherosclerosis
17991885 expression of endogenous rabbit peroxisome proliferator-activating receptor and VEGFR2 were significantly increased in the growth factor-transduced muscles, but these inductions were efficiently prevented by 15-LO-1.
17959182 A coding single nucleotide polymorphism in ALOX15 (T560M) results in a near null variant of human 12/15-LOX and this variant does not protect against coronary artery disease
17959182 Observational study of gene-disease association. (HuGE Navigator)
17711445 The switching of linoleic acid metabolism by reversal of the expression of 15LOX-1 and COX-2 is associated with acquisition of malignant potential in colonic neoplasia.
17662651 Results report that interleukin-4 (IL-4) induced the expression of 15-LO-1 in human cord blood derived mast cells (CBMC).
17652958 Observational study of gene-disease association. (HuGE Navigator)
17652958 variant alleles of rs2619112 and rs916055 and their haplotypes of ALOX15 are associated with high bone mineral density(BMD) in pre-menopausal women but low BMD in post-menopausal women
17520163 Observational study of gene-disease association. (HuGE Navigator)
17520163 there is no association between polymorphism in ALOX15 and bone mineral density phenotypes, but genetic variation in ALOX12 seems to play a role in determining bone structure in Caucasian women
17439326 Observational study of gene-disease association. (HuGE Navigator)
17439326 the c.-292C>T polymorphism was associated with higher enzyme activity in heterozygous carriers; this polymorphism also showed a tendency to be protective against atherosclerosis
17344094 The data presented link the stimulation of ERK-cPLA(2)-15-LO pathway by oxidized LDL to the prooxidant mechanism of the lipoprotein complex.
17227895 proposed a possible reaction pathway in 15-lipoxygenase reactions at lower oxygen content
17043146 12/15-lipoxygenase expression suppresses the growth of human Bcr-Abl+ leukemia K562 cells.
16997127 Results suggest that aberrant 15-lipoxygenase-1 overexpression in normal prostate can trigger events leading to prostate epithelial and stromal cell proliferation.
16847316 Results describe the shared stabilization functions of pyrimidine-rich determinants in the erythroid 15-lipoxygenase and alpha-globin mRNAs.
16598376 Observational study of gene-disease association. (HuGE Navigator)
16556493 Reduction of isoforms of 15-lipoxygenase (15-LOX)-1 and 15-LOX-2 in human breast cancer
16357157 Down-regulation of 15-Lipoxygenase-1 is associated with colorectal adenomas
16320347 The c.-292 T allele in the ALOX15 promoter generates a novel binding site for the transcription factor SPI1 that results in higher transcription of the gene in macrophages.
16179498 Overexpression of 15-lipoxygenase-1 induces growth arrest through phosphorylation of p53 in human colorectal cancer cells
16000313 ALOX15 generation of 15S-hydroxyeicosatetraenoic acid activates specific growth factor receptor-related signaling pathways, thereby initiating signal transduction events leading to increased cell adhesion to extracellular matrix in breast carcinoma cells
15996861 15-LO-1 is related to the differentiation of human nasal epithelium, and that it may mediate the mucociliary differentiation of human nasal epithelium.
15967444 Strong overexpression of 15-lipoxygenase1 was paralleled by downregulation of CD4 and CXCR4.
15912043 15-LOX-1 gene expression is significantly reduced in both human colorectal adenomas and carcinomas and is associated with decreased survival. Down regulation of 15-LOX-1 is an early event in the adenoma to carcinoma sequence.
15879104 The suppressive activity of antiproliferative myeloid suppressor cells (MSC) in the peritoneal cavity of mice infected with Taenia crassiceps depends on a switch from nitric oxide- to 12-15-lipoxygenase-dependent alternative activation MSC phenotype.
15838625 Observational study of gene-disease association. (HuGE Navigator)
15838625 These findings suggest that the ALOX15 gene is one of the genetic determinants of bone mineral density in postmenopausal women. Accordingly, this polymorphism could be useful as a genetic marker for predicting the risk of osteoporosis.
15459485 Studies using transgenic mice overexpressing human 15-lipoxygenase suggest a role for 15-LO in the natural selection of thymocytes.
15194425 Demethylation of the 15-LO promoter is a prerequisite for the gene transactivation, which contributes to tissue- and cell-type-specific regulation of 15-LO expression.
15111312 12/15-lipoxygenase is increased in Alzheimer's disease and has a possible role in brain oxidative stress
14757756 PKCdelta plays an important role in regulating 15-lipoxygenase expression in human monocytes and subsequently modulates the inflammatory responses mediated by 15-LO products
14643174 In athymic nude mice, transplantable tumors derived from 15-LO-1 HCT-116 cells were smaller than tumors derived from vector HCT-116 cells
12907138 human breast tumours aber;antly express decreased level of ALOX15. Lobular carcinomas had a lower level of ALOX15 than ductal carcinomas; the lowest level of ALOX15 was seen in TNM3 and TNM4 tumours and from patients who died of breast cancer.
12748293 Results provide evidence that interleukin-13 induces p38 MAP kinase phosphorylation and activation, which regulates Stat1 and Stat3 serine 727 phosphorylation.
12664628 This enzyme is induced when Ku antigen is the transcripion factor in human cells.
12664577 This enzyme is overexpressed in prostatic adenocarcinoma.
12084190 This article emphasizes the key role of 15-Lipoxygenase-1 in prostate, colorectal, and breast cancers.
11956198 metabolizes 2-arachidonylglycerol, an endo cannabinoid, to a peroxisome proliferator-activated receptor alpha agonist
11023533 15-LO-1 expression was significantly high in prostate adenocarcinoma and seen in secretory cells of peripheral zone glands, prostatic ducts and seminal vesicles, but not in the basal cell layer or stroma.
9700053 Characterizes the 15-lipoxygenase-1 promoter region and maps the gene to human chromosome 17p13.3.

AA Sequence

MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHL      1 - 70
LKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYR     71 - 140
WGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCG    141 - 210
QSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSL    211 - 280
LDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSS    281 - 350
DFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST    351 - 420
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVSLHYKTDVAVK    421 - 490
DDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCT    491 - 560
MRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREEL    561 - 630
AALDKEIEIRNAKLDMPYEYLRPSVVENSVAI                                          631 - 662
//

Text Mined References (172)

PMID Year Title
26871724 2016 Key Role of ROS in the Process of 15-Lipoxygenase/15-Hydroxyeicosatetraenoiccid-Induced Pulmonary Vascular Remodeling in Hypoxia Pulmonary Hypertension.
26646740 2016 How Can Linoleic Acid Be the Preferential Substrate of the Enzyme 15-Lipoxygenase-1? A QM/MM Approach.
26276392 2015 AMP-activated protein kinase suppresses arachidonate 15-lipoxygenase expression in interleukin 4-polarized human macrophages.
26194111 2015 The role of 15-LOX-1 in colitis and colitis-associated colorectal cancer.
26067486 2015 Genetic variants in arachidonic acid pathway genes associated with NSAID-exacerbated respiratory disease.
26036173 2015 Polymorphisms in inflammation associated genes ALOX15 and IL-6 are associated with bone properties in young women and fracture in elderly.
25708815 2015 The 12/15-lipoxygenase as an emerging therapeutic target for Alzheimer's disease.
25576922 2015 12/15 Lipoxygenase regulation of colorectal tumorigenesis is determined by the relative tumor levels of its metabolite 12-HETE and 13-HODE in animal models.
25549319 2015 Insulin-like growth factor I reduces lipid oxidation and foam cell formation via downregulation of 12/15-lipoxygenase.
25105362 2014 Arachidonate 15-lipoxygenase is required for chronic myeloid leukemia stem cell survival.
24955608 2014 Adipose tissue 12/15 lipoxygenase pathway in human obesity and diabetes.
24742828 2014 Correlation of ALOX15 expression with eosinophilic or reflux esophagitis in a cohort of pediatric patients with esophageal eosinophilia.
24668884 2014 Enzyme 15-lipoxygenase 1 promotes hypoxia-inducible factor 1? turnover and reduces vascular endothelial growth factor expression: implications for angiogenesis.
24634093 2014 15-LOX-1 suppression of hypoxia-induced metastatic phenotype and HIF-1? expression in human colon cancer cells.
24465480 2014 Interleukin-4-mediated 15-lipoxygenase-1 trans-activation requires UTX recruitment and H3K27me3 demethylation at the promoter in A549 cells.
23958500 2013 Molecular basis for the catalytic inactivity of a naturally occurring near-null variant of human ALOX15.
23872364 2013 Effect of human 15-lipoxygenase-1 metabolites on vascular function in mouse mesenteric arteries and hearts.
23844124 2013 Gene-metabolite expression in blood can discriminate allergen-induced isolated early from dual asthmatic responses.
23838566 2013 12/15-lipoxygenase expression is increased in oligodendrocytes and microglia of periventricular leukomalacia.
23828562 2013 Lack of effect of common single nucleotide polymorphisms in leukotriene pathway genes on platelet reactivity in patients with diabetes.
23528921 2013 12/15-lipoxygenase expressed in non-epithelial cells causes airway epithelial injury in asthma.
23474367 2013 15-lipoxygenase-1/15-hydroxyeicosatetraenoic acid promotes hepatocellular cancer cells growth through protein kinase B and heat shock protein 90 complex activation.
23404351 2013 Genetic variation in the lipoxygenase pathway and risk of colorectal neoplasia.
23285160 2012 Transcriptional regulation of 15-lipoxygenase expression by histone h3 lysine 4 methylation/demethylation.
23249676 2013 Inducible endothelium-derived hyperpolarizing factor: role of the 15-lipoxygenase-EDHF pathway.
23181793 2012 Genetic variants of the arachidonic acid pathway in non-steroidal anti-inflammatory drug-induced acute urticaria.
23079635 2013 Differential contribution of lipoxygenase isozymes to nigrostriatal vulnerability.
23066085 2013 15-Lipoxygenase-1-mediated metabolism of docosahexaenoic acid is required for syndecan-1 signaling and apoptosis in prostate cancer cells.
22960430 Eicosanoid profiling in colon cancer: emergence of a pattern.
22879973 2012 Characterization of a human 12/15-lipoxygenase promoter variant associated with atherosclerosis identifies vimentin as a promoter binding protein.
22825379 2012 Human 5-, 12- and 15-lipoxygenase-1 coexist in kidney but show opposite trends and their balance changes in cancer.
22750246 2012 High expression of arachidonate 15-lipoxygenase and proinflammatory markers in human ischemic heart tissue.
22652554 2012 Effect of genetic polymorphism of ALOX15 on aspirin-exacerbated respiratory disease.
22516296 2012 Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.
22472308 2012 Effects of gut-targeted 15-LOX-1 transgene expression on colonic tumorigenesis in mice.
22351111 2012 Association of ALOX15 gene polymorphism with ischemic stroke in Northern Chinese Han population.
22301860 2012 Association of ALOX15 gene polymorphisms with obesity-related phenotypes in Chinese nuclear families with male offspring.
22275252 2012 Transcriptional regulation of ?-secretase-1 by 12/15-lipoxygenase results in enhanced amyloidogenesis and cognitive impairments.
22210710 15-Lipoxygenase-1 induces lipid peroxidation and apoptosis, and improves survival in rat malignant glioma.
22094113 2012 Epigenetic and transcriptional control of the 15-lipoxygenase-1 gene in a Hodgkin lymphoma cell line.
22089472 2012 Polymorphisms in the human ALOX12 and ALOX15 genes are associated with peak bone mineral density in Chinese nuclear families.
22078795 Preeclampsia activates 15-lipoxygenase and its metabolite 15-hydroxyeicosatetraenoic acid enhances constriction in umbilical arteries.
22037943 2011 15-Lipoxygenase-1 as a tumor suppressor gene in colon cancer: is the verdict in?
21881028 2011 Mechanistic contribution of ubiquitous 15-lipoxygenase-1 expression loss in cancer cells to terminal cell differentiation evasion.
21831839 2011 15-Lipoxygenase 1 interacts with phosphatidylethanolamine-binding protein to regulate MAPK signaling in human airway epithelial cells.
21771656 2011 cPLA(2)? gene activation by IL-1? is dependent on an upstream kinase pathway, enzymatic activation and downstream 15-lipoxygenase activity: a positive feedback loop.
21558275 2011 Molecular basis for the reduced catalytic activity of the naturally occurring T560M mutant of human 12/15-lipoxygenase that has been implicated in coronary artery disease.
21544861 2011 15-lipoxygenase-1 exerts its tumor suppressive role by inhibiting nuclear factor-kappa B via activation of PPAR gamma.
21094135 2010 Differential expression and localization of 12/15 lipoxygenases in adipose tissue in human obese subjects.
20861348 2010 Monocyte 15-lipoxygenase gene expression requires ERK1/2 MAPK activity.
20676957 2010 Two single nucleotide polymorphisms in ALOX15 are associated with risk of coronary artery disease in a Chinese Han population.
20668019 2010 White tea extract induces apoptosis in non-small cell lung cancer cells: the role of peroxisome proliferator-activated receptor-{gamma} and 15-lipoxygenases.
20649594 2010 Honokiol inhibits gastric tumourigenesis by activation of 15-lipoxygenase-1 and consequent inhibition of peroxisome proliferator-activated receptor-gamma and COX-2-dependent signals.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20592751 2010 Human lipoxygenase pathway gene variation and association with markers of subclinical atherosclerosis in the diabetes heart study.
20570249 2010 Amelioration of the Alzheimer's disease phenotype by absence of 12/15-lipoxygenase.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20382140 2010 mRNA levels of enzymes and receptors implicated in arachidonic acid metabolism in gliomas.
20308035 2010 Common genetic variation, residential proximity to traffic exposure, and left ventricular mass: the multi-ethnic study of atherosclerosis.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19942621 2010 An integrated expression phenotype mapping approach defines common variants in LEP, ALOX15 and CAPNS1 associated with induction of IL-6.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19775287 2009 15-Lipoxygenase-1 expression suppresses the invasive properties of colorectal carcinoma cell lines HCT-116 and HT-29.
19752603 2009 15-lipoxygenase-1 in colorectal cancer: a review.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19663136 2009 Lack of association of ALOX12 and ALOX15 polymorphisms with aspirin-exacerbated respiratory disease in Korean patients.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19576981 2009 A 4-oxo-2(E)-nonenal-derived glutathione adduct from 15-lipoxygenase-1-mediated oxidation of cytosolic and esterified arachidonic acid.
19568414 2009 Prostate tumor growth can be modulated by dietarily targeting the 15-lipoxygenase-1 and cyclooxygenase-2 enzymes.
19528634 2009 15(S)-Lipoxygenase-1 associates with neutral lipid droplets in macrophage foam cells: evidence of lipid droplet metabolism.
19497113 2009 Expression of 5-lipoxygenase and 15-lipoxygenase in rheumatoid arthritis synovium and effects of intraarticular glucocorticoids.
19481615 2009 Structural basis for pH-dependent alterations of reaction specificity of vertebrate lipoxygenase isoforms.
19469483 2009 Mechanistic investigations of human reticulocyte 15- and platelet 12-lipoxygenases with arachidonic acid.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19429775 2009 15-Lipoxygenase-1 induces expression and release of chemokines in cultured human lung epithelial cells.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19325142 2009 Overexpression of human 15(S)-lipoxygenase-1 in RAW macrophages leads to increased cholesterol mobilization and reverse cholesterol transport.
19296842 2009 Human articular chondrocytes express 15-lipoxygenase-1 and -2: potential role in osteoarthritis.
19198625 2009 15-LOX-1 transcription suppression through the NuRD complex in colon cancer cells.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19131661 2009 Genetic variation in the leukotriene pathway and carotid intima-media thickness: a 2-stage replication study.
19131063 2009 No association of two functional polymorphisms in human ALOX15 with myocardial infarction.
19130894 2009 On the biosynthesis and biological role of eoxins and 15-lipoxygenase-1 in airway inflammation and Hodgkin lymphoma.
19089921 2009 Downregulation of vascular endothelial growth factor and induction of tumor dormancy by 15-lipoxygenase-2 in prostate cancer.
19046748 2009 Variation in eicosanoid genes, non-fatal myocardial infarction and ischemic stroke.
18799463 2008 Chromatin modification requirements for 15-lipoxygenase-1 transcriptional reactivation in colon cancer cells.
18785202 2008 15-lipoxygenase-1 activates tumor suppressor p53 independent of enzymatic activity.
18774388 2008 Genetic variation in immune signaling genes differentially expressed in asthmatic lung tissues.
18755188 2008 Reciprocal regulation of 12- and 15-lipoxygenases by UV-irradiation in human keratinocytes.
18692814 2009 Absence of association between a functional polymorphism of ALOX15 gene and infertility in endometriosis.
18684974 2008 The 15-lipoxygenase-modified high density lipoproteins 3 fail to inhibit the TNF-alpha-induced inflammatory response in human endothelial cells.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18647347 2008 Hodgkin Reed-Sternberg cells express 15-lipoxygenase-1 and are putative producers of eoxins in vivo: novel insight into the inflammatory features of classical Hodgkin lymphoma.
18547056 2008 Isotope sensitive branching and kinetic isotope effects in the reaction of deuterated arachidonic acids with human 12- and 15-lipoxygenases.
18392641 2008 15-Lipoxygenase gene variants are associated with carotid plaque but not carotid intima-media thickness.
18239141 2008 15-lipoxygenase-1 in the vasculature: expanding roles in angiogenesis.
18227726 2008 Polyunsaturated fatty acid metabolizing 15-Lipoxygenase-1 (15-LO-1) expression in normal and tumorigenic human bladder tissues.
18198215 2008 15-Lipoxygenase-1 transcriptional silencing by DNA methyltransferase-1 independently of DNA methylation.
18187376 2008 Lipoxygenase metabolites are mediators of PTH-dependent human osteoblast growth.
18180398 2008 Endothelial 15-lipoxygenase-1 overexpression increases acetylcholine-induced hypotension and vasorelaxation in rabbits.
18090132 2007 15-Lipoxygenase-2 is differentially expressed in normal and neoplastic ovary.
18067895 2008 15-Lipoxygenase-2 expression in human macrophages induces chemokine secretion and T cell migration.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17991885 2008 15-lipoxygenase-1 prevents vascular endothelial growth factor A- and placental growth factor-induced angiogenic effects in rabbit skeletal muscles via reduction in growth factor mRNA levels, NO bioactivity, and downregulation of VEGF receptor 2 expression.
17959182 2008 A near null variant of 12/15-LOX encoded by a novel SNP in ALOX15 and the risk of coronary artery disease.
17711445 2007 Reversal of expression of 15-lipoxygenase-1 to cyclooxygenase-2 is associated with development of colonic cancer.
17662651 2007 Expression of 15-lipoxygenase type-1 in human mast cells.
17652958 2008 A differential association of ALOX15 polymorphisms with bone mineral density in pre- and post-menopausal women.
17520163 2007 Polymorphisms in ALOX12, but not ALOX15, are significantly associated with BMD in postmenopausal women.
17439326 2007 The c.-292C>T promoter polymorphism increases reticulocyte-type 15-lipoxygenase-1 activity and could be atheroprotective.
17344094 2007 Activation of cytosolic phospholipase A2 and 15-lipoxygenase by oxidized low-density lipoproteins in cultured human lung fibroblasts.
17227895 2007 Intramolecular rearrangement of linolenate peroxyl radicals in lipoxygenase reactions at lower oxygen content.
17164146 2007 DNA methylation paradigm shift: 15-lipoxygenase-1 upregulation in prostatic intraepithelial neoplasia and prostate cancer by atypical promoter hypermethylation.
17052953 2006 Interaction of human 15-lipoxygenase-1 with phosphatidylinositol bisphosphates results in increased enzyme activity.
17043146 2006 Identification of 12/15-lipoxygenase as a suppressor of myeloproliferative disease.
16997127 2006 Orthotopic expression of human 15-lipoxygenase (LO)-1 in the dorsolateral prostate of normal wild-type C57BL/6 mouse causes PIN-like lesions.
16847316 2006 Shared stabilization functions of pyrimidine-rich determinants in the erythroid 15-lipoxygenase and alpha-globin mRNAs.
16820097 2006 Conditional expression of human 15-lipoxygenase-1 in mouse prostate induces prostatic intraepithelial neoplasia: the FLiMP mouse model.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16598376 2006 Human ALOX12, but not ALOX15, is associated with BMD in white men and women.
16556493 2006 Reduction of isoforms of 15-lipoxygenase (15-LOX)-1 and 15-LOX-2 in human breast cancer.
16357157 2005 The critical role of 15-lipoxygenase-1 in colorectal epithelial cell terminal differentiation and tumorigenesis.
16320347 2006 Functional polymorphism in ALOX15 results in increased allele-specific transcription in macrophages through binding of the transcription factor SPI1.
16179498 2005 Overexpression of 15-lipoxygenase-1 induces growth arrest through phosphorylation of p53 in human colorectal cancer cells.
16000313 2005 15S-Lipoxygenase-2 mediates arachidonic acid-stimulated adhesion of human breast carcinoma cells through the activation of TAK1, MKK6, and p38 MAPK.
15996861 2005 Expression of 15-lipoxygenase-1 in human nasal epithelium: its implication in mucociliary differentiation.
15967444 2005 Induction of 15-lipoxygenase-1 impairs expression of HIV-1 receptors CD4 and CXCR4 in monocytic cells.
15912043 2005 Tumor-associated down-regulation of 15-lipoxygenase-1 is reversed by celecoxib in colorectal cancer.
15879104 2005 Reactive oxygen species and 12/15-lipoxygenase contribute to the antiproliferative capacity of alternatively activated myeloid cells elicited during helminth infection.
15838625 2005 Association of a single nucleotide polymorphism in the lipoxygenase ALOX15 5'-flanking region (-5229G/A) with bone mineral density.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459485 2004 Overexpression of 15-lipoxygenase in the vascular endothelium is associated with increased thymic apoptosis in LDL receptor-deficient mice.
15194425 2004 Transcriptional regulation of 15-lipoxygenase expression by promoter methylation.
15111312 2004 12/15-lipoxygenase is increased in Alzheimer's disease: possible involvement in brain oxidative stress.
14757756 2004 Role of protein kinase C isoforms in the regulation of interleukin-13-induced 15-lipoxygenase gene expression in human monocytes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14643174 2004 15-Lipoxygenase-1 has anti-tumorigenic effects in colorectal cancer.
12907138 2003 Levels of expression of lipoxygenases and cyclooxygenase-2 in human breast cancer.
12748293 2003 Interleukin-13 induction of 15-lipoxygenase gene expression requires p38 mitogen-activated protein kinase-mediated serine 727 phosphorylation of Stat1 and Stat3.
12731864 2003 Kinetic investigations of the rate-limiting step in human 12- and 15-lipoxygenase.
12664628 2002 KU 70/80 lupus autoantigen is the transcription factor induced by interleukins (IL)-13 and -4 leading to induction of 15-lipoxygenase (15-LO) in human cells.
12664577 2002 15-lipoxygenase-1 overexpression in prostate adenocarcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12084190 2002 The effect of 15-lipoxygenase-1 expression on cancer cells.
11861792 2002 Leukotriene B4 production in human mononuclear phagocytes is modulated by interleukin-4-induced 15-lipoxygenase.
11475334 2001 Regulation of 15-lipoxygenase isozymes and mucin secretion by cytokines in cultured normal human bronchial epithelial cells.
11418015 Evaluation of the activity and localization of 15-lipoxygenase-1 after introduction into human colorectal carcinoma Caco-2 cells.
11278875 2001 12/15-lipoxygenase translocation enhances site-specific actin polymerization in macrophages phagocytosing apoptotic cells.
11196700 2000 Ku autoantigen (DNA helicase) is required for interleukins-13/-4-induction of 15-lipoxygenase-1 gene expression in human epithelial cells.
11023533 2000 Concordant induction of 15-lipoxygenase-1 and mutant p53 expression in human prostate adenocarcinoma: correlation with Gleason staging.
10464294 1999 Differential localization of 5- and 15-lipoxygenases to the nuclear envelope in RAW macrophages.
10200270 1999 Effects of mutant p53 expression on human 15-lipoxygenase-promoter activity and murine 12/15-lipoxygenase gene expression: evidence that 15-lipoxygenase is a mutator gene.
9931410 1999 A sensitive chemiluminescence method to measure the lipoxygenase catalyzed oxygenation of complex substrates.
9822675 1998 Induction of 15-lipoxygenase expression by IL-13 requires tyrosine phosphorylation of Jak2 and Tyk2 in human monocytes.
9700053 1998 Human 15-lipoxygenase gene promoter: analysis and identification of DNA binding sites for IL-13-induced regulatory factors in monocytes.
9414270 1998 Membrane translocation of 15-lipoxygenase in hematopoietic cells is calcium-dependent and activates the oxygenase activity of the enzyme.
9224951 1997 Characterization and sequence of an additional 15-lipoxygenase transcript and of the human gene.
7961680 1994 Induction of 15-lipoxygenase by interleukin-13 in human blood monocytes.
3356688 1988 Arachidonate 15-lipoxygenase (omega-6 lipoxygenase) from human leukocytes. Purification and structural homology to other mammalian lipoxygenases.
3202857 1988 Molecular cloning and primary structure of human 15-lipoxygenase.
3202520 1988 Arachidonic acid 15-lipoxygenase and airway epithelium. Biologic effects and enzyme purification.
2719708 1989 Occurrence of the erythroid cell specific arachidonate 15-lipoxygenase in human reticulocytes.
2010530 1991 Immunocytochemical localization of arachidonate 15-lipoxygenase in erythrocytes, leukocytes, and airway cells.
1944593 1991 A primary determinant for lipoxygenase positional specificity.
1825526 1991 Purification of 15-lipoxygenase from human leukocytes, evidence for the presence of isozymes.
1733732 1992 The expression of 15-lipoxygenase gene and the presence of functional enzyme in cytoplasm and nuclei of pregnancy human myometria.
1729692 1992 Specific inflammatory cytokines regulate the expression of human monocyte 15-lipoxygenase.
1662607 1991 Purification of two forms of arachidonate 15-lipoxygenase from human leukocytes.
1570320 1992 Characterization of human 12-lipoxygenase genes.
1566855 1992 Cloning of human airway 15-lipoxygenase: identity to the reticulocyte enzyme and expression in epithelium.