Property Summary

NCBI Gene PubMed Count 10
PubMed Score 17.90
PubTator Score 11.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 3.6e-06
pilocytic astrocytoma 3086 8.5e-05
medulloblastoma, large-cell 6234 1.5e-04
ovarian cancer 8491 1.7e-03


  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.664 3.6e-06
medulloblastoma, large-cell 1.200 1.5e-04
pilocytic astrocytoma 1.100 8.5e-05
ovarian cancer 1.100 1.7e-03

Gene RIF (5)

21285950 Many eukaryotic tRNAs contain the wobble modification 5-methoxycarbonylmethyl-uridine (mcm5U). It is demonstrated that (R)- and (S)-5-methoxycarbonylhydroxymethyluridine (mchm5U), hydroxylated forms of mcm(5)U, are present in mammalian tRNA-Arg(UCG), and tRNA-Gly(UCC), respectively. It is shown that the hydroxylation reaction leading to the formation of (S)-mchm5U is catalyzed by the oxygenase (AlkB) domain of ALKBH8.
20308323 Data show that human AlkB homolog 8 (ABH8) catalyzes tRNA methylation to generate 5-methylcarboxymethyl uridine (mcm(5)U) at the wobble position of certain tRNAs, a critical anticodon loop modification linked to DNA damage survival.
20123966 The methyltransferase domain of ALKBH8 is demonstrated to be a functional homologue of the Saccharomyces cerevisiae Trm9 protein, mediating the last step in the formation of the wobble uridine modification 5-methoxycarbonylmethyl-uridine in tRNA. This modification is shown to be important for efficient selenoprotein synthesis. ALKBH8 knock-out mice are generated and described.
19293182 Findings indicate a role for ALKBH8 in urothelial carcinoma cell survival mediated by NOX-1-dependent ROS signals, further suggesting therapeutic strategies in human bladder cancer by inducing JNK/p38/gammaH2AX-mediated cell death by silencing of ALKBH8.
18187620 Knockdown of alkB, alkylation repair homolog 8 (ALKBH8) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

REGELEGACRTVSDVRILQSYYDQGNWCVILQKA                                        631 - 664

Text Mined References (13)

PMID Year Title
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
22065580 2012 Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
21285950 2011 ALKBH8-mediated formation of a novel diastereomeric pair of wobble nucleosides in mammalian tRNA.
20308323 2010 Human AlkB homolog ABH8 Is a tRNA methyltransferase required for wobble uridine modification and DNA damage survival.
20123966 2010 Mammalian ALKBH8 possesses tRNA methyltransferase activity required for the biogenesis of multiple wobble uridine modifications implicated in translational decoding.
19293182 2009 A novel human AlkB homologue, ALKBH8, contributes to human bladder cancer progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17979886 Expression and sub-cellular localization of human ABH family molecules.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.