Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.38
PubTator Score 2.93

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25122757 ALKBH7 possesses the conserved double-stranded beta-helix fold that coordinates a catalytically active iron by a conserved HX(D/E) em leader Xn em leader H motif.
23666923 novel role for a AlkB homolog, human ALKBH7, in programmed necrosis, presenting a new target for therapeutic intervention in cancer cells that are resistant to apoptotic cell death

AA Sequence

MAGTGLLALRTLPGPSWVRGSGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAI      1 - 70
HGFRETEKSRWSEASRAILQRVQAAAFGPGQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSP     71 - 140
SVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMG    141 - 210
PGESGQPPPAC                                                               211 - 221
//

Text Mined References (12)

PMID Year Title
25122757 2014 The atomic resolution structure of human AlkB homolog 7 (ALKBH7), a key protein for programmed necrosis and fat metabolism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23666923 2013 Human ALKBH7 is required for alkylation and oxidation-induced programmed necrosis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
17979886 Expression and sub-cellular localization of human ABH family molecules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.