Property Summary

NCBI Gene PubMed Count 15
PubMed Score 31.47
PubTator Score 14.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.535 2.1e-03
pancreatic ductal adenocarcinoma liver m... -1.281 1.0e-02
ovarian cancer 1.500 6.4e-05

Gene RIF (6)

PMID Text
26047305 The ALKBH5 gene may play a role in conferring risk of MDD in the Chinese population.
24778178 Structures of human ALKBH5 demethylase reveal a unique binding mode for specific single-stranded N6-methyladenosine RNA demethylation.
24616105 findings provide a structural basis for understanding the substrate recognition specificity of Alkbh5 and offer a foundation for selective drug design against AlkB members
24489119 Modelling substrate into the active site of ALKBH5 reveals conserved residues important for recognition and demethylation mechanisms.
23177736 ALKBH5 is a RNA demethylase and its action strongly suggests that the reversible methyladenosine modification has fundamental and broad functions in mammalian cells.
21264265 ALKBH5 may have a role in the regulation of cellular responses to hypoxia as a class of HIF-transcriptional target gene

AA Sequence

MAAASGYTDLREKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAAAAEPYPVSGAKRKYQEDSDPERSD      1 - 70
YEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYT     71 - 140
YGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHI    141 - 210
FERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVI    211 - 280
ILRKTRLDAPRLETKSLSSSVLPPSYASDRLSGNNRDPALKPKRSHRKADPDAAHRPRILEMDKEENRRS    281 - 350
VLLPTHRRRGSFSSENYWRKSYESSEDCSEAAGSPARKVKMRRH                              351 - 394
//

Text Mined References (28)

PMID Year Title
26047305 2015 An association study of the m6A genes with major depressive disorder in Chinese Han population.
24778178 2014 Structures of human ALKBH5 demethylase reveal a unique binding mode for specific single-stranded N6-methyladenosine RNA demethylation.
24616105 2014 Crystal structures of the human RNA demethylase Alkbh5 reveal basis for substrate recognition.
24489119 2014 Structure of human RNA N?-methyladenine demethylase ALKBH5 provides insights into its mechanisms of nucleic acid recognition and demethylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23177736 2013 ALKBH5 is a mammalian RNA demethylase that impacts RNA metabolism and mouse fertility.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22761421 2012 Protein arginine methyltransferase 7 regulates cellular response to DNA damage by methylating promoter histones H2A and H4 of the polymerase ? catalytic subunit gene, POLD1.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21269460 2011 Initial characterization of the human central proteome.
21264265 2011 Human AlkB homologue 5 is a nuclear 2-oxoglutarate dependent oxygenase and a direct target of hypoxia-inducible factor 1? (HIF-1?).
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17979886 Expression and sub-cellular localization of human ABH family molecules.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997338 2002 Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.