Property Summary

NCBI Gene PubMed Count 28
PubMed Score 65.12
PubTator Score 34.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.2e-05
sonic hedgehog group medulloblastoma 467 6.9e-05

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 1.2e-05
sonic hedgehog group medulloblastoma 1.100 6.9e-05

PDB (18)

Gene RIF (18)

AA Sequence

MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYT      1 - 70
VLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLER     71 - 140
IRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRR    141 - 210
VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK                       211 - 261
//

Text Mined References (32)

PMID Year Title