Property Summary

NCBI Gene PubMed Count 27
PubMed Score 62.27
PubTator Score 34.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.2e-05
sonic hedgehog group medulloblastoma 1482 6.9e-05

Expression

  Differential Expression (2)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.100 6.9e-05
ovarian cancer 1.100 1.2e-05

Gene RIF (17)

PMID Text
26408825 studies reveal the ALKBH2 binding interface of PCNA and indicate that both germline and somatic ALKBH2 variants could have cellular effects on ALKBH2 function in DNA repair.
25797601 It was shown for first time that DNA glycosylase ALKBH2 can repair DNA adduct 1,N2-ethenoguanine.
23972994 ABH2 knockdown impairs rDNA transcription and leads to increased single-stranded and double-stranded DNA breaks in the rDNA genes.
23279696 ALKBH2 is an upstream molecule of the oncoprotein, MUC1, and regulates cell cycle and EMT, resulting in progression of urothelial carcinomas.
23258843 Overexpression of ALKBH2 is associated with enhanced resistance to temozolomide in glioblastoma.
22659876 combination of duplex interrogation and oxidation chemistry allows ALKBH2 to detect and process diverse lesions efficiently and correctly
22079122 The non-enzymatic binding of AAG to 3,N(4)-ethenocytosine specifically blocks ALKBH2-catalyzed repair of 3,N(4)-ethenocytosine but not that of methylated ALKBH2 substrates.
21510633 X-ray absorption spectroscopy structural investigation of early intermediates in the mechanism of DNA repair by human ABH2
21155885 ABH2 is downregulated in a subset of gastric cancers, and might be involved in the molecular mechanism of gastric cancer through inhibiting the proliferation of gastric cancer cells.
20714506 This work has provided a detailed understanding of the structural features of the single-stranded DNA and double-stranded DNA preferences of ABH2 and ABH3.
20661249 Tumour protein (TP53) is directly involved by binding to the promoter of ALKBH2 in mediating photofrin-mediaated photodynamic therapy in U87 glioma cells.
20525795 Divergent sequences outside of the active site determine substrate specificities of ABH2.
20042601 Data show that the JMJD1A/ABH2 family of dioxygenases is highly sensitive to inhibition by carcinogenic nickel ions.
19290481 Mutations of ABH2 is associated with pediatric brain tumors.
18519673 ABH2 is active in the direct reversal of epsilon A lesions, and that ABH2, together with the alkyl-N-adenine-DNA glycosylase, which is the most effective enzyme for the repair of epsilon A, comprise the cellular defense against epsilon A lesions
18432238 first crystal structure of ABH2
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYT      1 - 70
VLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLER     71 - 140
IRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRR    141 - 210
VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK                       211 - 261
//

Text Mined References (31)

PMID Year Title
26408825 2015 The interaction between ALKBH2 DNA repair enzyme and PCNA is direct, mediated by the hydrophobic pocket of PCNA and perturbed in naturally-occurring ALKBH2 variants.
25797601 2015 Differential repair of etheno-DNA adducts by bacterial and human AlkB proteins.
23972994 2013 ABH2 couples regulation of ribosomal DNA transcription with DNA alkylation repair.
23279696 2013 ALKBH2, a novel AlkB homologue, contributes to human bladder cancer progression by regulating MUC1 expression.
23258843 2013 The DNA repair protein ALKBH2 mediates temozolomide resistance in human glioblastoma cells.
22659876 2012 Duplex interrogation by a direct DNA repair protein in search of base damage.
22079122 2012 Direct repair of 3,N(4)-ethenocytosine by the human ALKBH2 dioxygenase is blocked by the AAG/MPG glycosylase.
21510633 2011 X-ray absorption spectroscopy structural investigation of early intermediates in the mechanism of DNA repair by human ABH2.
21269460 2011 Initial characterization of the human central proteome.
21155885 2011 Frequent down-regulation of hABH2 in gastric cancer and its involvement in growth of cancer cells.
20714506 2010 Mechanistic insight into the recognition of single-stranded and double-stranded DNA substrates by ABH2 and ABH3.
20661249 2010 TP53 regulates human AlkB homologue 2 expression in glioma resistance to Photofrin-mediated photodynamic therapy.
20525795 2010 Divergent ß-hairpins determine double-strand versus single-strand substrate recognition of human AlkB-homologues 2 and 3.
20223766 2010 Structure determination of DNA methylation lesions N1-meA and N3-meC in duplex DNA using a cross-linked protein-DNA system.
20042601 2010 Nickel ions inhibit histone demethylase JMJD1A and DNA repair enzyme ABH2 by replacing the ferrous iron in the catalytic centers.
19290481 2009 Pediatric brain tumors: mutations of two dioxygenases (hABH2 and hABH3) that directly repair alkylation damage.
18775698 2008 Oxidative demethylation of 3-methylthymine and 3-methyluracil in single-stranded DNA and RNA by mouse and human FTO.
18519673 2008 AlkB homologue 2-mediated repair of ethenoadenine lesions in mammalian DNA.
18432238 2008 Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
17979886 Expression and sub-cellular localization of human ABH family molecules.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16174769 2005 Repair of methylation damage in DNA and RNA by mammalian AlkB homologues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12594517 2003 Human and bacterial oxidative demethylases repair alkylation damage in both RNA and DNA.
12486230 2002 Reversal of DNA alkylation damage by two human dioxygenases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.