Property Summary

NCBI Gene PubMed Count 13
PubMed Score 108.13
PubTator Score 724.47

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26152727 AlkB has a wide variety of substrates, including monoalkyl and exocyclic bridged adducts. (Review)
23825659 ALKBH1's role in class switch recombination and abasic site cleavage during base excision repair
23577621 Primary and secondary lysine residues of ALKBH1 are involved in lyase reactions and form a covalent adduct with the 5'DNA product, demonstrating two plausible chemical mechanisms to account for the covalent attachment.
21956739 Homology modeling and different tertiary structure based study were performed on human AlkB homolog hABH1.
19959401 show that ABH1 unexpectedly has a second activity, cleaving DNA at abasic (AP) sites such as those arising spontaneously from alkylation-dependent depurination reactions.
18603530 hABH1 is a functional mitochondrial AlkB homolog that repairs 3-methylcytosine in single-stranded DNA and RNA.
12594517 AlkB homologues, hABH2 and hABH3, also are oxidative DNA demethylases; AlkB and hABH3, but not hABH2, also repair RNA

AA Sequence

MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVS      1 - 70
SVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEET     71 - 140
QDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFE    141 - 210
DFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSG    211 - 280
FSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATD    281 - 350
QNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPDS                                   351 - 389
//

Text Mined References (16)

PMID Year Title
26152727 2015 The AlkB Family of Fe(II)/?-Ketoglutarate-dependent Dioxygenases: Repairing Nucleic Acid Alkylation Damage and Beyond.
25459764 2014 Homology modeling, molecular dynamics, and site-directed mutagenesis study of AlkB human homolog 1 (ALKBH1).
23825659 2013 ALKBH1 is dispensable for abasic site cleavage during base excision repair and class switch recombination.
23577621 2013 A covalent protein-DNA 5'-product adduct is generated following AP lyase activity of human ALKBH1 (AlkB homologue 1).
22961808 2012 ALKBH1 is a histone H2A dioxygenase involved in neural differentiation.
22872573 2012 Genome-wide association study of prognosis in advanced non-small cell lung cancer patients receiving platinum-based chemotherapy.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21956739 2011 Homology modeling and function prediction of hABH1, involving in repair of alkylation damaged DNA.
19959401 2010 Human AlkB homologue 1 (ABH1) exhibits DNA lyase activity at abasic sites.
18603530 2008 Human AlkB homolog 1 is a mitochondrial protein that demethylates 3-methylcytosine in DNA and RNA.
17979886 Expression and sub-cellular localization of human ABH family molecules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12594517 2003 Human and bacterial oxidative demethylases repair alkylation damage in both RNA and DNA.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8600462 1996 Molecular cloning and functional analysis of a human cDNA encoding an Escherichia coli AlkB homolog, a protein involved in DNA alkylation damage repair.