Property Summary

NCBI Gene PubMed Count 19
PubMed Score 0.71
PubTator Score 16.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.200 9.9e-04
invasive ductal carcinoma -1.100 1.2e-02
osteosarcoma -2.102 2.8e-05
ovarian cancer -1.800 3.1e-07
pancreatic ductal adenocarcinoma liver m... -1.083 2.5e-02
subependymal giant cell astrocytoma -1.068 1.5e-02

Gene RIF (4)

AA Sequence

MASRGARQRLKGSGASSGDTAPAADKLRELLGSREAGGAEHRTELSGNKAGQVWAPEGSTAFKCLLSARL      1 - 70
CAALLSNISDCDETFNYWEPTHYLIYGEGFQTWEYSPAYAIRSYAYLLLHAWPAAFHARILQTNKILVFY     71 - 140
FLRCLLAFVSCICELYFYKAVCKKFGLHVSRMMLAFLVLSTGMFCSSSAFLPSSFCMYTTLIAMTGWYMD    141 - 210
KTSIAVLGVAAGAILGWPFSAALGLPIAFDLLVMKHRWKSFFHWSLMALILFLVPVVVIDSYYYGKLVIA    211 - 280
PLNIVLYNVFTPHGPDLYGTEPWYFYLINGFLNFNVAFALALLVLPLTSLMEYLLQRFHVQNLGHPYWLT    281 - 350
LAPMYIWFIIFFIQPHKEERFLFPVYPLICLCGAVALSALQKCYHFVFQRYRLEHYTVTSNWLALGTVFL    351 - 420
FGLLSFSRSVALFRGYHGPLDLYPEFYRIATDPTIHTVPEGRPVNVCVGKEWYRFPSSFLLPDNWQLQFI    421 - 490
PSEFRGQLPKPFAEGPLATRIVPTDMNDQNLEEPSRYIDISKCHYLVDLDTMRETPREPKYSSNKEEWIS    491 - 560
LAYRPFLDASRSSKLLRAFYVPFLSDQYTVYVNYTILKPRKAKQIRKKSGG                       561 - 611
//

Text Mined References (18)

PMID Year Title