Property Summary

NCBI Gene PubMed Count 35
PubMed Score 17.27
PubTator Score 63.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.148 9.8e-12
tuberculosis and treatment for 3 months -1.400 2.9e-06
ovarian cancer -2.100 1.5e-07

Protein-protein Interaction (2)

Gene RIF (17)

PMID Text
25667979 Results show the crystal structure of the complex between ALG-2 and a peptide of Sec31A and found that the peptide binds to the third hydrophobic pocket (Pocket 3) and that ALG-2 recognizing 2 types of motifs at different hydrophobic surfaces of Sec31A.
25534348 Lack of ALG-2, ALIX or Vps4B each prevents shedding, and repair of the injured cell membrane
25006245 ALG-2/Sec31A interactions were not required for the localization of Sec31A to ER exit sites per se but appeared to acutely regulate the stability and trafficking of the cargo receptor p24 and the distribution of the vesicle tether protein p115
24069399 ALG-2 attenuates COPII budding in vitro and stabilizes the Sec23/Sec31A complex.
23924735 The results of in vitro binding assays using purified recombinant proteins indicated that ALG-2 functions as a Ca(2)-dependent adaptor protein that bridges ALIX and ESCRT-I to form a ternary complex
23404334 We identify ALG14 and ALG2 as novel genes in which mutations cause a congenital myasthenic syndrome
22437941 This is the first report showing interaction of ALG-2 with a P-body component (PATL1).PATL1 as well as DCP1A, a well-known P-body marker, co-localized with a subset of ALG-2.
20834162 the alg2 binding site is one of the key determinants of the retention kinetics of Sec31A at endoplasmic reticulum exit sites
20691033 inability of the two-residue shorter ALG-2 isoform to bind Alix
20571937 found that targeting Requiem and Alg-2 did not result in extended culture viability, but resulted in an increase in maximum viable cell numbers and cumulative IVCD under fed-batch conditions
19520058 Ca2+-loaded ALG-2 bridges Alix and TSG101 as an adaptor protein.
19383317 analysed the expression of ALG-2 in 7371 tumor tissue samples of various origin; most notably, ALG-2 was upregulated in mesenchymal tumors.
19013425 These results indicate that ALG-2 has an anti-apoptotic function in HeLa cells by facilitating the passage through checkpoints in the G2/M cell cycle phase.
18936101 Alix and ALG-2 are new actors of the TNF-R1 pathway
17889823 ALG-2 binding to Scotin is strictly calcium dependent, indicating a role of this interaction in calcium signaling pathways
16004603 The expression and transport of ALG-2 in association with TSG101 and Vps4B are reported.
14999017 The ALG2 binding site is necessary for the punctate distribution of the carboxyl-terminal proline-rich region of Alix in HeLa cells.

AA Sequence

MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRC      1 - 70
AGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFP     71 - 140
DLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDS    141 - 210
VVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEH    211 - 280
YQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPL    281 - 350
ESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV        351 - 416
//

Text Mined References (34)

PMID Year Title
25667979 2015 Structural analysis of the complex between penta-EF-hand ALG-2 protein and Sec31A peptide reveals a novel target recognition mechanism of ALG-2.
25534348 2014 Mechanism of Ca²?-triggered ESCRT assembly and regulation of cell membrane repair.
25006245 2014 Apoptosis-linked gene-2 (ALG-2)/Sec31 interactions regulate endoplasmic reticulum (ER)-to-Golgi transport: a potential effector pathway for luminal calcium.
24069399 2013 ALG-2 attenuates COPII budding in vitro and stabilizes the Sec23/Sec31A complex.
23924735 2013 VPS37 isoforms differentially modulate the ternary complex formation of ALIX, ALG-2, and ESCRT-I.
23874384 2013 Genetics of callous-unemotional behavior in children.
23404334 2013 Congenital myasthenic syndromes due to mutations in ALG2 and ALG14.
22437941 2012 Identification of the P-body component PATL1 as a novel ALG-2-interacting protein by in silico and far-Western screening of proline-rich proteins.
21269460 2011 Initial characterization of the human central proteome.
20834162 2010 The ALG-2 binding site in Sec31A influences the retention kinetics of Sec31A at the endoplasmic reticulum exit sites as revealed by live-cell time-lapse imaging.
20691033 2010 Molecular basis for defect in Alix-binding by alternatively spliced isoform of ALG-2 (ALG-2DeltaGF122) and structural roles of F122 in target recognition.
20571937 2010 Simultaneous targeting of Requiem & Alg-2 in Chinese hamster ovary cells for improved recombinant protein production.
19946888 2010 Defining the membrane proteome of NK cells.
19520058 2009 Penta-EF-hand protein ALG-2 functions as a Ca2+-dependent adaptor that bridges Alix and TSG101.
19383317 2008 The apoptosis linked gene ALG-2 is dysregulated in tumors of various origin and contributes to cancer cell viability.
19013425 2009 ALG-2 knockdown in HeLa cells results in G2/M cell cycle phase accumulation and cell death.
18936101 2008 Alix and ALG-2 are involved in tumor necrosis factor receptor 1-induced cell death.
17889823 2007 The calcium binding protein ALG-2 binds and stabilizes Scotin, a p53-inducible gene product localized at the endoplasmic reticulum membrane.
17196169 2007 ALG-2 directly binds Sec31A and localizes at endoplasmic reticulum exit sites in a Ca2+-dependent manner.
17045351 2006 Nuclear translocation of the calcium-binding protein ALG-2 induced by the RNA-binding protein RBM22.
16957052 2006 The Ca2+-binding protein ALG-2 is recruited to endoplasmic reticulum exit sites by Sec31A and stabilizes the localization of Sec31A.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15273506 2004 Congenital disorders of glycosylation: a booming chapter of pediatrics.
15272470 2004 Congenital disorders of glycosylation (CDG): update and new developments.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12684507 2003 A new type of congenital disorders of glycosylation (CDG-Ii) provides new insights into the early steps of dolichol-linked oligosaccharide biosynthesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11883939 2002 ALG-2 interacts with the amino-terminal domain of annexin XI in a Ca(2+)-dependent manner.
11278427 2001 Peflin and ALG-2, members of the penta-EF-hand protein family, form a heterodimer that dissociates in a Ca2+-dependent manner.