Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.59
PubTator Score 1.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.400 1.1e-02
group 3 medulloblastoma 1.100 1.8e-02
posterior fossa group B ependymoma 1.300 1.3e-04
pancreatic carcinoma 1.400 1.1e-02
acute myeloid leukemia -1.600 3.4e-02
ovarian cancer 1.700 6.3e-05

Gene RIF (3)

PMID Text
23404334 We identify ALG14 and ALG2 as novel genes in which mutations cause a congenital myasthenic syndrome
18976975 Knockdown of asparagine-linked glycosylation 14 homolog (ALG14) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
16100110 ALG13 and ALG14 form a functional endoplasmic reticulum UDP-N-acetylglucosamine transferase

AA Sequence

MVCVLVLAAAAGAVAVFLILRIWVVLRSMDVTPRESLSILVVAGSGGHTTEILRLLGSLSNAYSPRHYVI      1 - 70
ADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSREVQQSWPSTVFTTLHSMWLSFPLIHRVKPDL     71 - 140
VLCNGPGTCVPICVSALLLGILGIKKVIIVYVESICRVETLSMSGKILFHLSDYFIVQWPALKEKYPKSV    141 - 210
YLGRIV                                                                    211 - 216
//

Text Mined References (9)

PMID Year Title
23404334 2013 Congenital myasthenic syndromes due to mutations in ALG2 and ALG14.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
17686769 2007 Membrane topology of the Alg14 endoplasmic reticulum UDP-GlcNAc transferase subunit.
16100110 2005 Alg14 recruits Alg13 to the cytoplasmic face of the endoplasmic reticulum to form a novel bipartite UDP-N-acetylglucosamine transferase required for the second step of N-linked glycosylation.
15615718 2005 Two proteins homologous to the N- and C-terminal domains of the bacterial glycosyltransferase Murg are required for the second step of dolichyl-linked oligosaccharide synthesis in Saccharomyces cerevisiae.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.