Property Summary

NCBI Gene PubMed Count 30
PubMed Score 43.09
PubTator Score 10.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 2.6e-02
glioblastoma -2.700 2.1e-03
posterior fossa group A ependymoma -2.200 2.2e-07
group 3 medulloblastoma -3.900 8.5e-08
atypical teratoid/rhabdoid tumor -4.100 8.3e-16
medulloblastoma, large-cell -4.200 6.6e-08
primitive neuroectodermal tumor -2.900 4.3e-04
adrenocortical carcinoma 1.460 2.2e-02
non-small cell lung cancer 1.380 1.1e-15
breast carcinoma -1.300 9.4e-04
fibroadenoma -1.200 4.5e-02
pediatric high grade glioma -2.800 2.7e-05
subependymal giant cell astrocytoma -3.276 8.2e-03
lung carcinoma 1.600 6.4e-28
ductal carcinoma in situ -1.800 3.8e-04
invasive ductal carcinoma -2.000 1.3e-03
psoriasis -1.100 1.1e-44

 IMPC Phenotype (1)

Protein-protein Interaction (10)

Gene RIF (9)

PMID Text
24993527 ALDOC, Aldolase A (ALDOA) and Aldolase B (ALDOB) activate Wnt signaling.
24525694 residues 85-102 harbor the epitope-containing region recognized by MAb 9F
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of fructose-bisphosphate aldolase C (ALDOC) expression by HIV-1 Vpr in Vpr transduced macrophages
20381070 This protein has been found differentially expressed in the anterior cingulate cortex in men patients with schizophrenia.
19686046 Results identified fructose bisphospate aldolase C that showed elevated levels of protein carbonyls in inferior parietal lobule (IPL) from subjects with early stage-Alzheimer's disease.
19405953 This protein has been found differentially expressed in the Wernicke's Area from patients with schizophrenia.
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
15589842 Diverse ALDOC promoter regions are required to direct specific LacZ expression in the hippocampus and Purkinje cells if transgenic mice.

AA Sequence

MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRV      1 - 70
KKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKK     71 - 140
DGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL    141 - 210
AAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEA    211 - 280
SFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDG    281 - 350
GAAAQSLYIANHAY                                                            351 - 364
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24993527 2014 Aldolase positively regulates of the canonical Wnt signaling pathway.
24525694 A novel anti-aldolase C antibody specifically interacts with residues 85-102 of the protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
19686046 2010 Redox proteomic analysis of carbonylated brain proteins in mild cognitive impairment and early Alzheimer's disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19405953 2009 Proteome analysis of schizophrenia patients Wernicke's area reveals an energy metabolism dysregulation.
19110265 2009 Proteomic analysis of dorsolateral prefrontal cortex indicates the involvement of cytoskeleton, oligodendrocyte, energy metabolism and new potential markers in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
15589842 2004 Diverse human aldolase C gene promoter regions are required to direct specific LacZ expression in the hippocampus and Purkinje cells of transgenic mice.
15537755 2004 Structure of human brain fructose 1,6-(bis)phosphate aldolase: linking isozyme structure with function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11876650 2002 Phospholipase D2 directly interacts with aldolase via Its PH domain.
11399750 2001 Interaction between aldolase and vacuolar H+-ATPase: evidence for direct coupling of glycolysis to the ATP-hydrolyzing proton pump.
9244396 1997 Mode of interactions of human aldolase isozymes with cytoskeletons.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
6696436 1984 Human skeletal-muscle aldolase: N-terminal sequence analysis of CNBr- and o-iodosobenzoic acid-cleavage fragments.
5230152 1966 Multiple forms of fructose diphosphate aldolase in mammalian tissues.
3674018 1987 Evolutionary implications of the human aldolase-A, -B, -C, and -pseudogene chromosome locations.
3267224 1988 The complete nucleotide sequence of the gene coding for the human aldolase C.
3105602 1987 The complete amino acid sequence of the human aldolase C isozyme derived from genomic clones.
2731939 1989 Assignment of human aldolase C gene to chromosome 17, region cen----q21.1.
2209624 1990 Characterization of the transcription-initiation site and of the promoter region within the 5' flanking region of the human aldolase C gene.