Property Summary

NCBI Gene PubMed Count 85
PubMed Score 118.58
PubTator Score 42.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.500 1.1e-03
pancreatic cancer 1.100 6.1e-06
lung adenocarcinoma 1.392 4.9e-12
ovarian cancer 2.500 3.1e-07

Protein-protein Interaction (10)

Gene RIF (23)

PMID Text
26854714 In vitro and in vivo results demonstrated that ALDOA was associated with proliferation and metastasis of pancreatic cancer cells.
26824656 Study shows that PI3K directly coordinates glycolysis with cytoskeletal dynamics in an AKT-independent manner. Growth factors or insulin stimulate the PI3K-dependent activation of Rac, leading to disruption of the actin cytoskeleton, release of filamentous actin-bound aldolase A, and an increase in aldolase activity.
25392908 Our results expand the clinical spectrum of aldolase A deficiency to isolated temperature-dependent rhabdomyolysis, and suggest that thermolability may be tissue specific. We also propose a treatment for this severe disease
25215901 Study provides evidence supporting a critical functional role of ALDOA in osteosarcoma progression, metastasis and perhaps chemoresistance.
24993527 ALDOC, Aldolase A (ALDOA) and Aldolase B (ALDOB) activate Wnt signaling.
24465716 ALDOA is highly expressed in lung squamous cell carcinoma (LSCC) and its expression level is correlated with LSCC metastasis, grades, differentiation status and poor prognosis.
23886627 The results presented here point to ALDA as a factor involved in the regulation of cells proliferation.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of aldolase A (ALDOA) expression by HIV-1 Vpr in Vpr transduced macrophages
22996014 The new prognostic biomarkers GRP78, Fructose-bisphosphate Aldolase A (ALDOA), Carbonic Anhydrase I (CA1) and Peptidyl-prolyl cis-trans isomerase A or Cyclophilin A (PPIA)) provided good survival prediction for TNM stage I-IV patients.
22949271 The expression of ALDOA and/or SULT1A3 is significantly higher.
22944692 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of aldolase A (ALDOA) expression by HIV-1 Vpr in Vpr transduced macrophages
21555518 ALDOA is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21307348 Data that aldolase forms a complex with ARNO/Arf6 and the V-ATPase and that it may contribute to remodeling of the actin cytoskeleton.
20511553 Posttranslational nitration of aldolase A may be an important pathway that regulates mast cell phenotype and function.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
20362419 ALDOA is involved in keratinocyte migration following the induction of lamellipodia formation, and ALDOA-related migration is enhanced by EGF
20181627 melanoma antigen expressed in G361, a representative melanoma cell line/ reacted with autoantibodies in patient sera
19741270 ZNF224 recruits the arginine methyltransferase PRMT5 on the transcriptional repressor complex of the aldolase A gene
19242545 Observational study of gene-disease association. (HuGE Navigator)
18328256 Aldolase A may play a role in the radio-response of human cells, probably in nuclei, in addition to its glycolytic role in the cytosol.
18278581 Results identify VDAC2 and aldolase A as membrane proteins of K562 cells with increased expression under iron deprivation.
18214967 The existence of highly AMP-sensitive muscle-like FBPase, activity of which is regulated by metabolite-dependent interaction with aldolase enables the precise regulation of muscle energy expenditures.
14766013 Gly346 is crucial for the correct conformation and function of aldolase A, because it governs the entry/release of the substrates into/from the enzyme cleft, and/or allows important C-terminal residues to approach the active site.

AA Sequence

MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRV      1 - 70
NPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKK     71 - 140
DGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL    141 - 210
AAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEA    211 - 280
SINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG    281 - 350
AAASESLFVSNHAY                                                            351 - 364
//

Text Mined References (103)

PMID Year Title
26854714 2016 ALDOA functions as an oncogene in the highly metastatic pancreatic cancer.
26824656 2016 Phosphoinositide 3-Kinase Regulates Glycolysis through Mobilization of Aldolase from the Actin Cytoskeleton.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25392908 2014 A thermolabile aldolase A mutant causes fever-induced recurrent rhabdomyolysis without hemolytic anemia.
25215901 2014 Role of aldolase A in osteosarcoma progression and metastasis: in vitro and in vivo evidence.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24993527 2014 Aldolase positively regulates of the canonical Wnt signaling pathway.
24465716 2014 Fructose-bisphosphate aldolase a is a potential metastasis-associated marker of lung squamous cell carcinoma and promotes lung cell tumorigenesis and migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23886627 2013 Nuclear localization of aldolase A correlates with cell proliferation.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22996014 2012 New prognosis biomarkers identified by dynamic proteomic analysis of colorectal cancer.
22949271 2014 Proteomic profiling of osteosarcoma cells identifies ALDOA and SULT1A3 as negative survival markers of human osteosarcoma.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21908771 2011 The first identification of lysine malonylation substrates and its regulatory enzyme.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21307348 2011 Aldolase directly interacts with ARNO and modulates cell morphology and acidic vesicle distribution.
21269460 2011 Initial characterization of the human central proteome.
20849852 2010 Proliferating cell nuclear antigen in the cytoplasm interacts with components of glycolysis and cancer.
20511553 2010 Protein tyrosine nitration of aldolase in mast cells: a plausible pathway in nitric oxide-mediated regulation of mast cell function.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
20362419 2010 Fructose-1,6-bisphosphate aldolase A is involved in HaCaT cell migration by inducing lamellipodia formation.
20181627 Identification of melanoma antigens using a Serological Proteome Approach (SERPA).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19741270 2009 The Kruppel-like zinc finger protein ZNF224 recruits the arginine methyltransferase PRMT5 on the transcriptional repressor complex of the aldolase A gene.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19242545 2009 Association and mutation analyses of 16p11.2 autism candidate genes.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18328256 2008 Involvement of aldolase A in X-ray resistance of human HeLa and UV(r)-1 cells.
18278581 2008 VDAC2 and aldolase A identified as membrane proteins of K562 cells with increased expression under iron deprivation.
18214967 2008 Evolutionary conserved N-terminal region of human muscle fructose 1,6-bisphosphatase regulates its activity and the interaction with aldolase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17641064 2007 Exosomes with immune modulatory features are present in human breast milk.
17329259 2007 A hydrophobic pocket in the active site of glycolytic aldolase mediates interactions with Wiskott-Aldrich syndrome protein.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15952740 Protein profiling of human pancreatic islets by two-dimensional gel electrophoresis and mass spectrometry.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14766013 2004 Human aldolase A natural mutants: relationship between flexibility of the C-terminal region and enzyme function.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14669989 Thermodynamic analysis of the dissociation of the aldolase tetramer substituted at one or both of the subunit interfaces.
14615364 2004 Hemolytic anemia and severe rhabdomyolysis caused by compound heterozygous mutations of the gene for erythrocyte/muscle isozyme of aldolase, ALDOA(Arg303X/Cys338Tyr).
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12519789 2003 Proteomic and biochemical analyses of human B cell-derived exosomes. Potential implications for their function and multivesicular body formation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11876650 2002 Phospholipase D2 directly interacts with aldolase via Its PH domain.
11399750 2001 Interaction between aldolase and vacuolar H+-ATPase: evidence for direct coupling of glycolysis to the ATP-hydrolyzing proton pump.
11287212 2001 Quantitative expression studies of aldolase A, B and C genes in developing embryos and adult tissues of Xenopus laevis.
10369770 1999 Developmental regulation of the aldolase A muscle-specific promoter during in vivo muscle maturation is controlled by a nuclear receptor binding element.
10048322 1999 Crystal structure of human muscle aldolase complexed with fructose 1,6-bisphosphate: mechanistic implications.
9244396 1997 Mode of interactions of human aldolase isozymes with cytoskeletons.
8598869 1996 Brief report: inherited metabolic myopathy and hemolysis due to a mutation in aldolase A.
8103323 1993 Aldolase-tubulin interactions: removal of tubulin C-terminals impairs interactions.
7821789 1994 Construction of a human full-length cDNA bank.
6696436 1984 Human skeletal-muscle aldolase: N-terminal sequence analysis of CNBr- and o-iodosobenzoic acid-cleavage fragments.
6406231 1983 Interaction of the dissociable glycerol-3-phosphate dehydrogenase and fructose-1,6-bisphosphate aldolase. Quantitative analysis by an extrinsic fluorescence probe.
3840020 1985 Nucleotide sequence of a cDNA clone for human aldolase: a messenger RNA in the liver.
3674018 1987 Evolutionary implications of the human aldolase-A, -B, -C, and -pseudogene chromosome locations.
3570299 1987 Molecular gene mapping of human aldolase A (ALDOA) gene to chromosome 16.
3441006 1987 Characterization of three optional promoters in the 5' region of the human aldolase A gene.
3391172 1988 Human aldolase A gene. Structural organization and tissue-specific expression by multiple promoters and alternate mRNA processing.
3355497 1988 The complete amino acid sequence of human skeletal-muscle fructose-bisphosphate aldolase.
3046960 1988 Aldolase C is localized in neuroendocrine cells.
3030757 1987 A new human species of aldolase A mRNA from fibroblasts.
2825199 1987 Human aldolase A deficiency associated with a hemolytic anemia: thermolabile aldolase due to a single base mutation.
2335208 1990 The crystal structure of human muscle aldolase at 3.0 A resolution.
2229018 1990 Human aldolase A of a hemolytic anemia patient with Asp-128----Gly substitution: characteristics of an enzyme generated in E. coli transfected with the expression plasmid pHAAD128G.
2065091 1991 Modulation of the interaction between aldolase and glycerol-phosphate dehydrogenase by fructose phosphates.
2056525 1991 Activity and specificity of human aldolases.
1999195 1991 An additional promoter functions in the human aldolase A gene, but not in rat.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1353685 1992 Identification of transglutaminase substrates in HT29 colon cancer cells: use of 5-(biotinamido)pentylamine as a transglutaminase-specific probe.
1008835 1976 Aldolase binding to actin-containing filaments. Formation of paracrystals.
955981 1976 Differentiation of epithelial cells in human jejunum: localization and quantification of aminopeptidase, alkaline phosphatase and aldolase isozymes in tissue sections.
844801 1977 The changes in aldolase isoenzyme pattern during development of the human kidney and small intestine--demonstrated in organ extracts and tissue sections.
766744 1975 Histological examination of the aldolase monomer composition of cells from human kidney and hypernephroid carcinoma.