Property Summary

NCBI Gene PubMed Count 17
PubMed Score 15.57
PubTator Score 9.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.400 1.7e-04
atypical teratoid / rhabdoid tumor -1.600 1.5e-05
colon cancer -2.200 2.6e-02
ductal carcinoma in situ -1.200 2.0e-03
gastric carcinoma -2.000 1.1e-02
glioblastoma -1.100 2.4e-05
group 3 medulloblastoma -1.900 9.0e-05
interstitial cystitis -1.200 1.5e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.3e-03
invasive ductal carcinoma -1.200 9.9e-03
lung cancer -1.600 1.6e-03
malignant mesothelioma -2.300 2.5e-07
medulloblastoma, large-cell -1.200 7.5e-04
nephrosclerosis -1.452 1.0e-02
osteosarcoma 1.678 1.1e-03
ovarian cancer -1.100 4.2e-03
pancreatic ductal adenocarcinoma liver m... -2.966 6.3e-03
primitive neuroectodermal tumor -1.300 6.3e-04
psoriasis -1.200 3.0e-06
ulcerative colitis -1.100 1.6e-05
Waldenstrons macroglobulinemia 1.109 2.2e-02

Gene RIF (5)

AA Sequence

MAALLAAAAVRARILQVSSKVKSSPTWYSASSFSSSVPTVKLFIGGKFVESKSDKWIDIHNPATNEVIGR      1 - 70
VPQATKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIAKLITLEQGKTLADAEGDVFR     71 - 140
GLQVVEHACSVTSLMMGETMPSITKDMDLYSYRLPLGVCAGIAPFNFPAMIPLWMFPMAMVCGNTFLMKP    141 - 210
SERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNKAGEYIFERGSRHGKRV    211 - 280
QANMGAKNHGVVMPDANKENTLNQLVGAAFGAAGQRCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGDQ    281 - 350
PGADLGPLITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFG    351 - 420
PVLVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIPVPLPMFSFTGSRSS    421 - 490
FRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR                             491 - 535
//

Text Mined References (22)

PMID Year Title