Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 16.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -2.166 1.7e-05
adrenocortical carcinoma -1.087 5.4e-05
tuberculosis 1.300 1.6e-05
pancreatic ductal adenocarcinoma liver m... 1.014 4.0e-02
non-small cell lung cancer -1.990 1.5e-17
intraductal papillary-mucinous adenoma (... 1.200 4.1e-04
lung cancer -2.400 6.0e-06
subependymal giant cell astrocytoma 1.437 5.1e-03
lung adenocarcinoma -1.200 1.3e-06
nasopharyngeal carcinoma -1.400 1.9e-07
chronic rhinosinusitis -1.618 2.4e-02

Gene RIF (10)

PMID Text
23721920 the likely physiological function of ALDH3B1 is to oxidize lipid-derived aldehydes generated in the plasma membrane and not to be involved in the sphingolipid metabolism in the endoplasmic reticulum.
20729348 The specificity of ALDH3B1 distribution may prove to be directly related to the functional role of this enzyme in human tissues.
20699116 protects cells from the damaging effects of oxidative stress
20237496 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19159868 These findings provided convincing evidence that epistasis between the catechol-O-methyltransferase and aldehyde dehydrogenase 3B1 genes plays an important role in the pathogenesis of schizophrenia
19159868 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17382292 This study shows for the first time the functionality, expression and protective role of ALDH3B1 and indicates a potential physiological role of ALDH3B1 against oxidative stress.
17382292 Initial characterization of human ALDH3B1 suggests a potential physiological role of this protein in oxidative stress processes.
16092759 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGE      1 - 70
VTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPS     71 - 140
EISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHLTPVTLE    141 - 210
LGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSP    211 - 280
NLGRIINQKQFQRLRALLGCGRVAIGGQSDESDRYIAPTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDE    281 - 350
AIEFINRREKPLALYAFSNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKFSFD    351 - 420
TFSHHRACLLRSPGMEKLNALRYPPQSPRRLRMLLVAMEAQGCSCTLL                          421 - 468
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23721920 2013 Substrate specificity, plasma membrane localization, and lipid modification of the aldehyde dehydrogenase ALDH3B1.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20729348 2010 Aldehyde dehydrogenase 3B1 (ALDH3B1): immunohistochemical tissue distribution and cellular-specific localization in normal and cancerous human tissues.
20699116 2010 Molecular characterization, expression analysis, and role of ALDH3B1 in the cellular protection against oxidative stress.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19159868 2009 Evidence of epistasis between the catechol-O-methyltransferase and aldehyde dehydrogenase 3B1 genes in paranoid schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17382292 2007 Expression and initial characterization of human ALDH3B1.
16092759 2005 Multi-locus association study of schizophrenia susceptibility genes with a posterior probability method.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9490025 1998 Human aldehyde dehydrogenase gene family.
9161417 1997 Human aldehyde dehydrogenase genes, ALDH7 and ALDH8: genomic organization and gene structure comparison.
7828891 1994 Cloning of a cDNA encoding human ALDH7, a new member of the aldehyde dehydrogenase family.