Property Summary

NCBI Gene PubMed Count 45
PubMed Score 197.17
PubTator Score 96.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Sjogren-Larsson syndrome 6 6.708 3.4
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
Sj??gren-Larsson syndrome 1

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -1.100 8.8e-03
acute quadriplegic myopathy 1.073 7.9e-05
adrenocortical carcinoma -1.168 4.2e-07
Atopic dermatitis -1.100 2.0e-02
Chronic Lymphocytic Leukemia 1.278 2.6e-04
colon cancer -1.300 1.2e-02
cutaneous lupus erythematosus -2.200 4.2e-04
ductal carcinoma in situ -1.400 7.8e-04
ependymoma 1.200 5.8e-08
esophageal adenocarcinoma -1.700 2.8e-02
Gaucher disease type 1 -1.800 4.0e-02
invasive ductal carcinoma -1.700 2.6e-03
lung cancer 1.700 1.5e-04
malignant mesothelioma -1.400 1.9e-06
medulloblastoma, large-cell -1.300 4.5e-03
osteosarcoma 2.197 4.7e-06
ovarian cancer -2.800 6.7e-12
psoriasis -1.400 2.0e-08
tuberculosis 1.400 1.6e-06
X-linked cerebral adrenoleukodystrophy -1.600 4.5e-02

Gene RIF (27)

AA Sequence

MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDF      1 - 70
MLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELS     71 - 140
ENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGG    141 - 210
KSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYE    211 - 280
RIINLRHFKRILSLLEGQKIAFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAIN    281 - 350
FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS    351 - 420
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLVKAEYY         421 - 485
//

Text Mined References (47)

PMID Year Title