Property Summary

NCBI Gene PubMed Count 55
PubMed Score 137.78
PubTator Score 117.01

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (9)

Gene RIF (30)

PMID Text
26751691 ALDH3A1 has a role in the maintenance of corneal epithelial homeostasis by simultaneously modulating proliferation and differentiation through both enzymatic and non-enzymatic mechanisms
26124079 Down-regulation of ALDH3 activity in trophoblast stem cells initiates trophoblast differentiation during placental development.
25221425 Reported increased expression of ALDH3A1, PDIA3, and PRDX2 in pterygia using a proteomic approach. These proteins are presumed to have a protective role against oxidative stress-induced apoptosis.
24762960 While ALDH3A1 was not found in prostate glands, it was present in prostatic intraepithelial neoplasia, further increased in carcinomas, and upregulated in lymphatic metastases. ALDH3A1 increased in DU145-cell-derived lung metastasis vs. local xenografts.
24316006 SiRNA-mediated suppression of ALDH3A1 blocked ALDH enzymatic activity and augmented cytotoxicity in CSE-exposed cells.
24276407 No correlation between ALDH3A1 expression and patient survival or tumour recurrence was observed.In conclusion, ALDH3A1 is a marker of activation of the Wnt/ss-catenin pathway in hepatocellular carcinoma
22406320 ALDH3A1 provides exceptional protection from the adverse effects of pathophysiological concentrations of 4-HNE such as may occur during periods of oxidative stress
21251908 through modulation of PPARgamma or ALDH3A1, it may be possible to reduce cell proliferation in tumor cells or stimulate cell proliferation in normal cells during tissue regeneration.
21229876 Antihypertensives, nonopioid analgesics and hormonal contraceptives significantly affect the salivary ALDH3A1 activity.
21203538 the UV-induced inactivation of ALDH3A1 is a result of non-native aggregation and associated structural changes rather than specific damage to the active site Cys
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20102361 Observational study of gene-disease association. (HuGE Navigator)
20056567 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19894643 the mechanism of salivary ALDH3A1 inactivation must be related to free radical activity, presumably in the salivary gland, but it is not simply correlated with antioxidatn capacity of saliva
19696793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19360691 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19025616 specific down regulation of ALDH1A1 and ALDH3A1 in Lenti 1+3 cells and in comparison to 12 other ALDH genes detected
18854779 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18621017 These kinetic properties ensure that ALDHs, and particularly ALDH2, can complete the ADH-mediated detoxification.
18536178 In most cases, ALDH3A1 activity in tumor and bordering tissues was higher than in a control group
18496131 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15905174 ALDH3A1 may protect corneal epithelial cells against oxidative damage not only through its metabolic function but also by prolonging the cell cycle
14745454 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12943535 Enzyme activity and localization of ALDH3A1 in the cornea.
12706498 ALDH3A1 is a regulatory element of the cellular defense system that protects corneal epithelium against UV-induced oxidative damage
12367788 ADH3*1 allele associated with high ADH activity and acetyaldehyde-DNA adducts in lung; may be a risk factor for lung cancer
9855707 These findings suggest that a high level of expression of ALDH3 in cancerous liver tissues resulted from the expression or activation of at least two nuclear proteins reacting to the ALDH3 promoter region.

AA Sequence

MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAYYEEVVYVLEE      1 - 70
IEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQPMVGAIAAGNSVVLKPS     71 - 140
ELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKERFDHILYTGSTGVGKIIMTAAAKHLTPVTLE    141 - 210
LGGKSPCYVDKNCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSR    211 - 280
DYGRIISARHFQRVMGLIEGQKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEE    281 - 350
AIQFINQREKPLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE    351 - 420
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH                                         421 - 453
//

Text Mined References (60)

PMID Year Title
26751691 2016 ALDH3A1 Plays a Functional Role in Maintenance of Corneal Epithelial Homeostasis.
26124079 2015 FBXL12-Mediated Degradation of ALDH3 is Essential for Trophoblast Differentiation During Placental Development.
25221425 2014 Proteomic analysis in pterygium; upregulated protein expression of ALDH3A1, PDIA3, and PRDX2.
24762960 2014 Aldehyde dehydrogenase 3A1 associates with prostate tumorigenesis.
24316006 2014 Aldehyde dehydrogenase 3A1 protects airway epithelial cells from cigarette smoke-induced DNA damage and cytotoxicity.
24276407 2014 ALDH3A1 is overexpressed in a subset of hepatocellular carcinoma characterised by activation of the Wnt/ß-catenin pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22406320 2012 Molecular mechanisms of ALDH3A1-mediated cellular protection against 4-hydroxy-2-nonenal.
22021038 2011 Discovery of a novel class of covalent inhibitor for aldehyde dehydrogenases.
21269460 2011 Initial characterization of the human central proteome.
21251908 2011 Importance of inverse correlation between ALDH3A1 and PPAR? in tumor cells and tissue regeneration.
21229876 Salivary aldehyde dehydrogenase activity--influence of drugs intake, preliminary research.
21203538 2010 Structural and functional modifications of corneal crystallin ALDH3A1 by UVB light.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20102361 2010 Genotype frequencies of selected drug metabolizing enzymes and ABC drug transporters among breast cancer patients on FAC chemotherapy.
20056567 2010 Childhood brain tumors, residential insecticide exposure, and pesticide metabolism genes.
19894643 The oxidation status of ALDH3A1 in human saliva and its correlation with antioxidant capacity measured by ORAC method.
19696793 2009 Association study of genetic polymorphism in ABCC4 with cyclophosphamide-induced adverse drug reactions in breast cancer patients.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19360691 2008 Examination of association to autism of common genetic variationin genes related to dopamine.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19025616 2008 ALDH isozymes downregulation affects cell growth, cell motility and gene expression in lung cancer cells.
18854779 2008 Relations between polymorphisms in drug-metabolising enzymes and toxicity of chemotherapy with cyclophosphamide, thiotepa and carboplatin.
18621017 2008 Detoxification of promutagenic aldehydes derived from methylpyrenes by human aldehyde dehydrogenases ALDH2 and ALDH3A1.
18536178 Fluorimetric detection of aldehyde dehydrogenase activity in human tissues in diagnostic of cancers of oral cavity.
18496131 2008 Influence of polymorphisms of drug metabolizing enzymes (CYP2B6, CYP2C9, CYP2C19, CYP3A4, CYP3A5, GSTA1, GSTP1, ALDH1A1 and ALDH3A1) on the pharmacokinetics of cyclophosphamide and 4-hydroxycyclophosphamide.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15905174 2005 Human aldehyde dehydrogenase 3A1 inhibits proliferation and promotes survival of human corneal epithelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
14745454 2004 Association study of an SNP combination pattern in the dopaminergic pathway in paranoid schizophrenia: a novel strategy for complex disorders.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12943535 2003 Human aldehyde dehydrogenase 3A1 (ALDH3A1): biochemical characterization and immunohistochemical localization in the cornea.
12706498 2003 Aldh3a1 protects human corneal epithelial cells from ultraviolet- and 4-hydroxy-2-nonenal-induced oxidative damage.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12367788 2002 Effects of the ADH3, CYP2E1, and GSTP1 genetic polymorphisms on their expressions in Caucasian lung tissue.
12081471 2002 Structural aspects of aldehyde dehydrogenase that influence dimer-tetramer formation.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
10780262 1999 Eukaryotic aldehyde dehydrogenase (ALDH) genes: human polymorphisms, and recommended nomenclature based on divergent evolution and chromosomal mapping.
9855707 1998 Expression of human aldehyde dehydrogenase-3 associated with hepatocellular carcinoma: promoter regions and nuclear protein factors related to the expression.
9514081 1998 Inhibition of human class 3 aldehyde dehydrogenase, and sensitization of tumor cells that express significant amounts of this enzyme to oxazaphosphorines, by chlorpropamide analogues.
9250352 1997 Mutations associated with Sjögren-Larsson syndrome.
9027499 1997 Genomic organization and expression of the human fatty aldehyde dehydrogenase gene (FALDH).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8493892 1993 Human stomach aldehyde dehydrogenase, ALDH3.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7774944 1995 Assignment of ALDH3 to human chromosome 17p11.2 and ALDH5 to human chromosome 9p13.
7625577 1995 Polymorphism of a class 3 aldehyde dehydrogenase present in human saliva and in hair roots.
7228061 1981 Stomach aldehyde dehydrogenase: report of a new locus.
4073832 1985 Chromosome assignment, biochemical and immunological studies on a human aldehyde dehydrogenase, ALDH3.
4015840 Biochemical genetic analysis of human and rodent aldehyde dehydrogenase (ALDH).
2037078 1991 Structural features of stomach aldehyde dehydrogenase distinguish dimeric aldehyde dehydrogenase as a 'variable' enzyme. 'Variable' and 'constant' enzymes within the alcohol and aldehyde dehydrogenase families.
1905102 1991 Biochemical, immunological, and molecular characterization of a "high Km" aldehyde dehydrogenase.
1737758 1992 Human stomach aldehyde dehydrogenase cDNA and genomic cloning, primary structure, and expression in Escherichia coli.
1306115 1992 Molecular genetics of human aldehyde dehydrogenase.