Property Summary

NCBI Gene PubMed Count 35
PubMed Score 52.53
PubTator Score 22.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -2.000 3.1e-02
lung cancer 2.200 9.2e-06
osteosarcoma -2.893 5.7e-10
pancreatic ductal adenocarcinoma liver m... -1.484 1.1e-03
psoriasis -4.400 1.7e-04

Protein-protein Interaction (3)

Gene RIF (23)

AA Sequence

MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAE      1 - 70
GDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLASLETLDNGKPFQESYALDLD     71 - 140
EVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKV    141 - 210
AEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLK    211 - 280
RVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGN    281 - 350
PFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP    351 - 420
VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGN    421 - 490
GRELGEDGLKAYTEVKTVTIKVPQKNS                                               491 - 517
//

Text Mined References (39)

PMID Year Title