Property Summary

NCBI Gene PubMed Count 32
PubMed Score 49.32
PubTator Score 22.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -4.400 1.7e-04
osteosarcoma -2.893 5.7e-10
pancreatic ductal adenocarcinoma liver m... -1.484 1.1e-03
lung cancer 2.200 9.2e-06
acute myeloid leukemia -2.000 3.1e-02

Synonym

Accession P30837 B2R8F0 Q8WX76 Q9BV45
Symbols ALDH5
ALDHX

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 IMPC Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (21)

PMID Text
26566217 ALDH1B1 is expressed at very high levels in human pancreatic cancer, and it contributes to proliferation in these tumor cells.
26366059 High expression of ALDH1A2 and ALDH1B1 mRNA was found to be significantly correlated to worser survival in all NSCLC patients.
25950950 Data show that ALDH1B1 may promote colon cancer tumorigenesis by modulating the Wnt/beta-catenin, Notch and PI3K/Akt signaling pathways.
25413692 ALDH1B1 metabolizes nitroglycerin and all-trans-retinaldehyde. One of the three human polymorphisms, ALDH1B1*2, is catalytically inactive, likely due to poor NAD(+) binding.
25311581 ALDH1B1 SNPs play a role in shaping the alcohol drinking patterns among the Inuit in Greenland.
25047496 Our findings provide clear evidence for both individual and interactive associations of ALDH1b1 and ALDH2 genes with the development of coronary artery disease in Han Chinese.
24953984 ALDH1 is indicative of stemness and is a biomarker marker in colon cancer.
23667679 Telomere lengths in 52 distinct iodine-unstained lesions with reference to both their size and multiplicity, ALDH2 and ADH1B genotypes, and smoking history, were investigated.
23454351 Mitochondrial NAD dependent aldehyde dehydrogenase either from yeast or human replaces yeast cytoplasmic NADP dependent aldehyde dehydrogenase for the aerobic growth of yeast on ethanol.
23247008 Molecular modeling studies examining predicted protein-protein interactions indicated that heterotetramerization between ALDH2 and ALDH1B1 subunits was highly probable and may partially explain a lack of compensation by ALDH1B1 in ALDH2( *)2 individuals.
21216231 ALDH1B1 is more profoundly expressed in the adenocarcinomas examined in this study relative to ALDH1A1 and that ALDH1B1 is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.
20955166 An ALDHX model based on the crystal structure of human ALDH2, reveals similarities with the previously described ALDH structures. Analyses indicate a close structural and functional relationship between the two isoenzymes of human origin
20877624 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20700531 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20205700 a common SNP encoding ALDH1b1 (rs2228093) was found to be significantly associated with alcohol-induced hypersensitivity.
20205700 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
18782342 ALDH1b1 ala69val was associated with diastolic blood pressure in a Caucasian population sample
17628022 Retinoic-acid-induced RAR-CAK signaling events appear to proceed intrinsically during granulocytic development of normal primitive hematopoietic cells. ALDH-governed RA availability may mediate this process by initiating RAR-CAK signaling.
17471563 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAE      1 - 70
GDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLASLETLDNGKPFQESYALDLD     71 - 140
EVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAPALATGNTVVMKV    141 - 210
AEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLK    211 - 280
RVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGN    281 - 350
PFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP    351 - 420
VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGN    421 - 490
GRELGEDGLKAYTEVKTVTIKVPQKNS                                               491 - 517
//

Text Mined References (36)

PMID Year Title
26566217 2016 Aldehyde Dehydrogenase 1B1 as a Modulator of Pancreatic Adenocarcinoma.
26366059 2015 Distinct prognostic values and potential drug targets of ALDH1 isoenzymes in non-small-cell lung cancer.
25950950 2015 ALDH1B1 Is Crucial for Colon Tumorigenesis by Modulating Wnt/?-Catenin, Notch and PI3K/Akt Signaling Pathways.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25413692 2015 Human ALDH1B1 polymorphisms may affect the metabolism of acetaldehyde and all-trans retinaldehyde--in vitro studies and computational modeling.
25311581 2014 Genetic variation in alcohol metabolizing enzymes among Inuit and its relation to drinking patterns.
25047496 2014 Synergistic association between two alcohol metabolism relevant genes and coronary artery disease among Chinese hypertensive patients.
24953984 2014 The impact of Aldehyde dehydrogenase 1 expression on prognosis for metastatic colon cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23667679 2013 Telomere shortening in the esophagus of Japanese alcoholics: relationships with chromoendoscopic findings, ALDH2 and ADH1B genotypes and smoking history.
23454351 2013 Mitochondrial NAD dependent aldehyde dehydrogenase either from yeast or human replaces yeast cytoplasmic NADP dependent aldehyde dehydrogenase for the aerobic growth of yeast on ethanol.
23247008 2013 Comparative genomics, molecular evolution and computational modeling of ALDH1B1 and ALDH2.
21269460 2011 Initial characterization of the human central proteome.
21216231 2011 Aldehyde dehydrogenase 1B1 (ALDH1B1) is a potential biomarker for human colon cancer.
20955166 2011 Structural modeling studies of aldehyde dehydrogenase X: insights into key interactions in the tetrameric assembly of the isoenzyme.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20700531 2010 The association of alcohol and alcohol metabolizing gene variants with diabetes and coronary heart disease risk factors in a white population.
20205700 2010 Genetic determinants of both ethanol and acetaldehyde metabolism influence alcohol hypersensitivity and drinking behaviour among Scandinavians.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18782342 2008 The association of ADH and ALDH gene variants with alcohol drinking habits and cardiovascular disease risk factors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17628022 2007 Intrinsic retinoic acid receptor alpha-cyclin-dependent kinase-activating kinase signaling involves coordination of the restricted proliferation and granulocytic differentiation of human hematopoietic stem cells.
17471563 2007 Contribution of the alcohol dehydrogenase-1B genotype and oral microorganisms to high salivary acetaldehyde concentrations in Japanese alcoholic men.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8689400 1996 Distribution of messenger RNAs for aldehyde dehydrogenase 1, aldehyde dehydrogenase 2, and aldehyde dehydrogenase 5 in human tissues.
8244338 1993 Diverse polymorphism within a short coding region of the human aldehyde dehydrogenase-5 (ALDH5) gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7779080 1995 The novel aldehyde dehydrogenase gene, ALDH5, encodes an active aldehyde dehydrogenase enzyme.
7774944 1995 Assignment of ALDH3 to human chromosome 17p11.2 and ALDH5 to human chromosome 9p13.
2061311 1991 Cloning and characterization of a new functional human aldehyde dehydrogenase gene.
1306115 1992 Molecular genetics of human aldehyde dehydrogenase.