Property Summary

NCBI Gene PubMed Count 42
PubMed Score 82.92
PubTator Score 61.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -8.500 3.2e-10
ependymoma -1.100 1.6e-02
oligodendroglioma -1.100 5.6e-03
psoriasis 2.100 8.3e-71
osteosarcoma -2.518 4.1e-02
cystic fibrosis 3.805 1.0e-07
adrenocortical carcinoma -1.564 2.1e-02
primary pancreatic ductal adenocarcinoma 1.018 1.1e-02
intraductal papillary-mucinous adenoma (... -2.100 3.5e-03
intraductal papillary-mucinous carcinoma... -2.500 1.2e-03
breast carcinoma -1.400 1.2e-03
pilocytic astrocytoma 3.100 2.2e-07
sonic hedgehog group medulloblastoma 2.800 1.4e-03
primary Sjogren syndrome -1.200 3.2e-02
aldosterone-producing adenoma -1.677 1.2e-02
acute myeloid leukemia -1.300 4.5e-02
subependymal giant cell astrocytoma -1.623 4.9e-03
invasive ductal carcinoma -1.304 1.1e-02
nasopharyngeal carcinoma -2.000 4.1e-07
Breast cancer -3.900 4.5e-22
gastric carcinoma 2.300 7.7e-03
ovarian cancer -4.100 6.7e-10
pituitary cancer -3.500 5.4e-11

Protein-protein Interaction (7)

Gene RIF (29)

PMID Text
26687806 the prevalence of ALDH1A3(+)/CD44(+) tumor cells in breast cancer is significantly associated with worse prognostic factors and favors a poor prognosis
26575197 ALDH1A3 was most relevant to extracellular matrix organization and cell adhesion biological process, and the ability of tumor invasion was suppressed after ALDH1A3 knockdown in vitro.
26352270 Whole-exome sequencing in a South American cohort links ALDH1A3, FOXN1 and RARB/retinoic acid regulation pathways to autism spectrum disorders.
25969992 ALDH1A3 is a target of miR-187 in human prostate cancer.
25868979 we demonstrated that a specific ALDH isoform, namely ALDH1A3, is enriched in chemoresistant mesothelioma cell subpopulations
25793304 the distribution of RALDH1, RALDH2, and RALDH3 in the postnatal eye was determined.
25684492 Increased hypermethylation of ALDH1A3 is associated with Glioblastoma.
25656374 Among unique genes up-regulated by Y15 in Lovo-1 and K1 resistant cells, a stem cell marker-ALDH1A3-was detected to be up-regulated >twofold.
25106087 ALDH1A3 induces differential RA signaling in breast cancer cells which affects the rate of breast cancer progression.
24907115 High ALDH1A3 expression is associated with non-small cell lung cancer.
24884875 At the transcript level, the cisplatin + DEAB-resistant cells showed upregulated mRNA expression levels for ALDH1A2, ALDH1A3 isozymes and CD44 indicating the involvement of these markers in conferring chemoresistance
24777706 Mutations in ALDH1A3 represent a frequent cause of microphthalmia/anophthalmia in consanguineous families.
24568872 Novel ALDH1A3 mutations identified in the present study confirm the pivotal role of ALDH1A3 in human eye development.
24053169 ALDH1A3 may be upregulated in pancreatic cancer
24047698 ALDH1A3 expression determines the stem cell-like cellular states in EGFR-mutant non-small cell lung cancer; a novel mechanism of acquired resistance to erlotinib can be targeted with the natural polyphenol silibinin.
23881059 Nine individuals, from one inbred kindred, segregating isolated A/M with orbital cysts were homozygous for a missense mutation in the gene encoding the A3 isoform of the ALDH1A3.
23650391 two subtypes of GSCs, harboring distinct metabolic signaling pathways, represent intertumoral glioma heterogeneity and highlight previously unidentified roles of ALDH1A3-associated signaling that promotes aberrant proliferation of Mes HGGs and GSCs.
23646827 Our data support the very recent and independent identification of ALDH1A3 as a disease gene in microphthalmia.
23591992 Results show that ALDH1A3 loss of function causes anophthalmia and aberrant eye development in humans and in animal model systems.
23436614 The methylation status of Homeobox A9 (HOXA9), ISL LIM homeobox 1 (ISL1) and Aldehyde dehydrogenase 1 family, member A3 (ALDH1A3) was significantly associated with decreased gene expression levels
23312594 Homozygosity for one splice-site and two missense mutations in the gene encoding the A3 isoform of the aldehyde dehydrogenase 1 (ALDH1A3) in three consanguineous families, is reported.
23250514 The effects of phenotypic and morphological alterations by DEAB on oral keratinocytes are mainly consequent to the inhibition of ALDH1A3 activity.
22131125 ALDH1A3 transcripts are detected at high levels in luminal progenitor-enriched fractions obtained from short-term adherent cultures of freshly isolated normal human mammary cells.
21280157 ALDH1A3 expression in patient breast tumors correlates significantly with tumor grade, metastasis, and cancer stage
20709019 these results indicate that the regulation of the retinoic acid metabolism in the epidermis involves transcriptional activation of ALDH1A3, possibly representing a positive feedback loop, which enhances the effect of exogenous retinoic acid.
19703508 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19478994 Gene duplication event that gave rise to Aldh1a1 and Aldh1a2 was more recent than the duplication event that gave rise to Aldh1a3.
19343046 Observational study of gene-disease association. (HuGE Navigator)
7698756 play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation.

AA Sequence

MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQICEVEEGDKPD      1 - 70
VDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETMDTGKPFLHAFFIDLEGCIRT     71 - 140
LRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTMVLKPAEQTP    141 - 210
LTALYLGSLIKEAGFPPGVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLE    211 - 280
LGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVK    281 - 350
TEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL    351 - 420
KFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGFKMSGNGRELG    421 - 490
EYALAEYTEVKTVTIKLGDKNP                                                    491 - 512
//

Text Mined References (44)

PMID Year Title
26687806 2016 ALDH(+)/CD44(+) cells in breast cancer are associated with worse prognosis and poor clinical outcome.
26575197 2015 ALDH1A3: A Marker of Mesenchymal Phenotype in Gliomas Associated with Cell Invasion.
26352270 2015 Whole-Exome Sequencing in a South American Cohort Links ALDH1A3, FOXN1 and Retinoic Acid Regulation Pathways to Autism Spectrum Disorders.
25969992 2015 MiR-187 Targets the Androgen-Regulated Gene ALDH1A3 in Prostate Cancer.
25868979 2015 A STAT3-NFkB/DDIT3/CEBP? axis modulates ALDH1A3 expression in chemoresistant cell subpopulations.
25793304 2015 Identification of active retinaldehyde dehydrogenase isoforms in the postnatal human eye.
25684492 2015 Prognostic value of ALDH1A3 promoter methylation in gliob;astoma: a single center experience in Western China.
25656374 2015 Down-regulation of ALDH1A3, CD44 or MDR1 sensitizes resistant cancer cells to FAK autophosphorylation inhibitor Y15.
25106087 2015 Aldehyde dehydrogenase 1A3 influences breast cancer progression via differential retinoic acid signaling.
24907115 2014 Essential role of aldehyde dehydrogenase 1A3 for the maintenance of non-small cell lung cancer stem cells is associated with the STAT3 pathway.
24884875 2014 Cisplatin-resistant cells in malignant pleural mesothelioma cell lines show ALDH(high)CD44(+) phenotype and sphere-forming capacity.
24777706 2014 Mutations in ALDH1A3 represent a frequent cause of microphthalmia/anophthalmia in consanguineous families.
24568872 2014 Novel splice-site and missense mutations in the ALDH1A3 gene underlying autosomal recessive anophthalmia/microphthalmia.
24167362 2013 Positive ALDH1A3 and negative GPX3 expressions are biomarkers for poor prognosis of gallbladder cancer.
24053169 2013 An integrated transcriptome and epigenome analysis identifies a novel candidate gene for pancreatic cancer.
24047698 2013 Stem cell-like ALDH(bright) cellular states in EGFR-mutant non-small cell lung cancer: a novel mechanism of acquired resistance to erlotinib targetable with the natural polyphenol silibinin.
24024553 2014 A homozygous mutation in a consanguineous family consolidates the role of ALDH1A3 in autosomal recessive microphthalmia.
23881059 2014 A missense mutation in ALDH1A3 causes isolated microphthalmia/anophthalmia in nine individuals from an inbred Muslim kindred.
23650391 2013 Mesenchymal glioma stem cells are maintained by activated glycolytic metabolism involving aldehyde dehydrogenase 1A3.
23646827 2013 Mutations in ALDH1A3 cause microphthalmia.
23591992 2013 ALDH1A3 loss of function causes bilateral anophthalmia/microphthalmia and hypoplasia of the optic nerve and optic chiasm.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23436614 2013 HOXA9, ISL1 and ALDH1A3 methylation patterns as prognostic markers for nonmuscle invasive bladder cancer: array-based DNA methylation and expression profiling.
23312594 2013 ALDH1A3 mutations cause recessive anophthalmia and microphthalmia.
23250514 2013 Distinct expression patterns and roles of aldehyde dehydrogenases in normal oral mucosa keratinocytes: differential inhibitory effects of a pharmacological inhibitor and RNAi-mediated knockdown on cellular phenotype and epithelial morphology.
22960273 2013 Genome-wide DNA methylation profiling identifies ALDH1A3 promoter methylation as a prognostic predictor in G-CIMP- primary glioblastoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22131125 2012 Aldehyde dehydrogenase activity is a biomarker of primitive normal human mammary luminal cells.
21280157 2011 Aldehyde dehydrogenase activity of breast cancer stem cells is primarily due to isoform ALDH1A3 and its expression is predictive of metastasis.
21269460 2011 Initial characterization of the human central proteome.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20833146 2010 Raldh3 expression in diabetic islets reciprocally regulates secretion of insulin and glucagon from pancreatic islets.
20709019 2010 Aldehyde dehydrogenase 1A3 is transcriptionally activated by all-trans-retinoic acid in human epidermal keratinocytes.
19703508 2009 Positive association between ALDH1A2 and schizophrenia in the Chinese population.
19478994 2009 Consequences of lineage-specific gene loss on functional evolution of surviving paralogs: ALDH1A and retinoic acid signaling in vertebrate genomes.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15245423 2004 Hair cycle-specific immunolocalization of retinoic acid synthesizing enzymes Aldh1a2 and Aldh1a3 indicate complex regulation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12040753 2002 Evaluation of gene induction of drug-metabolizing enzymes and transporters in primary culture of human hepatocytes using high-sensitivity real-time reverse transcription PCR.
11585737 2001 Retinoic acid biosynthesis by normal human breast epithelium is via aldehyde dehydrogenase 6, absent in MCF-7 cells.
9490025 1998 Human aldehyde dehydrogenase gene family.
7698756 1994 Molecular cloning, genomic organization, and chromosomal localization of an additional human aldehyde dehydrogenase gene, ALDH6.