Property Summary

NCBI Gene PubMed Count 226
PubMed Score 583.43
PubTator Score 484.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
urothelial carcinoma -2.400 3.7e-02
esophageal adenocarcinoma 1.300 3.3e-02
psoriasis -1.300 1.7e-02
posterior fossa group A ependymoma -3.700 2.5e-08
glioblastoma -3.800 3.3e-06
group 4 medulloblastoma -4.400 3.8e-10
atypical teratoid / rhabdoid tumor -3.100 6.4e-03
medulloblastoma, large-cell -4.500 1.4e-07
primitive neuroectodermal tumor -3.200 4.9e-03
hereditary spastic paraplegia -1.349 5.7e-03
Atopic dermatitis -1.800 6.4e-05
adrenocortical carcinoma -3.081 3.8e-03
tuberculosis 3.800 1.9e-07
colon cancer -1.400 1.5e-02
lung cancer -1.700 2.5e-04
breast carcinoma -2.000 1.8e-23
fibroadenoma -2.300 2.3e-04
interstitial cystitis -1.200 1.5e-03
lung adenocarcinoma -2.200 3.6e-06
pediatric high grade glioma -3.700 3.5e-09
pilocytic astrocytoma -3.900 5.2e-11
Breast cancer -2.600 1.0e-02
invasive ductal carcinoma -1.800 8.4e-03
nasopharyngeal carcinoma -2.000 7.0e-03
lung carcinoma -2.100 5.7e-07
ductal carcinoma in situ -1.700 1.1e-04
acute myeloid leukemia -3.000 3.3e-03
ovarian cancer -5.200 1.7e-19
pituitary cancer -2.500 4.2e-03
chronic rhinosinusitis -1.465 3.3e-02

Synonym

Accession P00352 O00768 Q5SYR1 RALDH 1
Symbols ALDC
ALDH1
HEL-9
HEL12
PUMB1
ALDH11
RALDH1
ALDH-E1
HEL-S-53e

Gene

PANTHER Protein Class (2)

PDB

4WB9   4WJ9   4WP7   4WPN   4X4L   5AC2  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (8)

Gene RIF (204)

PMID Text
27239845 Even at early stages of malignant transformation, a significant decrease in ADH1B, ADH3, RDHL, and RALDH1 mRNA levels was observed in 82, 79, 73, and 64% of tumor specimens, respectively
26896768 ALDH1A1 stabilizes the Gli2 protein in an enzyme-independent manner hepatocellular cancer.ALDH1A1 is a positive regulator of the Hedgehog signaling pathway.
26682730 Data show that high ALDH1 expression indicates a poor prognosis in colorectal cancer patients correlating with the T stage, N stage, and tumor differentiation, but not with age. [review]
26625750 Detecting the expression of CD133 and ALDH1 in invasive ductal breast carcinomas may be of help in more accurately predicting the aggressive properties and determining the optimal treatment.
26617768 Immunohistochemistry results indicate that combination with ALDH1 and STAT6 can improve the diagnostic value of CD34 for solitary fibrous tumors.
26517640 Cancer stem cell markers are variably expressed in prostate adenocarcinoma and immunohistochemical staining for ALDH1 and EZH2 may have a role in predicting tumour aggressiveness before treatment of prostate cancer
26462023 Data suggest that high expression of aldehyde dehydrogenase 1A1 (ALDH1A1) mRNA in tumor tissues may be an independent predictor of a favorable triple-negative breast cancer (TNBC) outcome.
26449187 salivary gland mucoepidermoid carcinomas contain a small population of cancer stem cells with enhanced tumorigenic potential and that are characterized by high ALDH activity and CD44 expression
26398662 Combined expression of ALDH1A1(high) and beta-catenin(c) was associated with lymph node metastasis, poor outcome, and resistance to cyclophosphamide treatment.
26358078 High expressions of ALDH1 is associated with lymph node metastasis in colorectal cancer.
26305673 ALDH1 expression in tumor-associated stromal cells indicates reduced breast carcinoma progression, possibly via retinoic acid secretion
26298632 Basal like tumors are enriched for cancer stem cells (CSC) with CD44(+)/CD24(-/low) phenotype. CD133 can detect a different population of CSC in breast carcinoma
26254374 The cancer stem-like cell marker ALDH1 can be used as a predictive factor for adverse pathological outcomes and prognosis in transitional cell carcinoma. of the renal pelvis.
26230297 Studies suggest that aldehyde dehydrogenase 1A1 (ALDH1A1) may be a stem cell marker in lung cancer (LC) and breast cancer (BC).
26175266 ALDH1A1 is associated with distant disease-free survival and clinicopathological variables, both in cancer cells and stroma, but is highly cut-off dependent.
26160842 ALDH1A1-overexpressing cells appear to be differentiated cells rather than cancer stem cells in hepatocellular carcinoma.
26148881 High expression of cancer stem cell marker ALDH1 in ovarian carcinoma cells may thus portend a favorable prognosis, but its expression in tumor microenvironment may have no role in tumor behavior of ovarian carcinomas.
26130650 Expression analysis revealed upregulation of IL6 and CD126 and GP130 in ALDH(hi) endometrial cancer ... targeted inhibition of the IL6 receptor and its downstream effectors JAK1 and STAT3 reduced tumor cell growth.
26080709 ALDH activity in myeloid cells in the colon of ulcerative colitis patients, regardless of whether the disease is active or in remission, is influenced by the intestinal environment.
26070788 ALDH1 may play an important role in the invasion of breast cancer, and may be associated with aggressive phenotypes of breast cancer.
26063415 negative phenotype and high proliferative index, but not ALDH1 expression, are predictive of good pathological response to neoadjuvant chemotherapy in locally advanced breast cancer
26046383 Results show that over-expression of both ALDH1 and CD133 were only found in non small cell carcinoma and adenocarcinoma (ADC) types of lung neoplasm but only, the low expression of ALDH1 was associated with more aggressive tumor in ADC patients.
25999351 increased ALDH1 expression after treatment identifies patients with aggressive tumor phenotypes in ovarian cancer.
25963795 High ALDH1 expression is associated with high-grade neuroendocrine carcinoma of the lung.
25921687 This meta-analysis shows ALDH1 expression in lung cancer is connected with decreased overall and disease free survival and thus marks a worse prognosis.
25881507 Expression of LGR5 and ALDH1A1 was associated with the tumorigenicity, metastasis and poor prognosis of NSCLC, and LGR5 cells in NSCLC were likely have stem cell-like properties due to the significant correlation between LGR5 and ALDH1A1.
25864109 We showed that knockdown of ALDH1 expression reduced the cell migration ability of HeLa cells, whereas augmented expression of ALDH1 increased cell migration
25843691 These data indicate that ALDH1 expression plays an important role in bladder cancer development and prognosis
25793304 the distribution of RALDH1, RALDH2, and RALDH3 in the postnatal eye was determined.
25710579 Prognostic Significance of CD44v6, CD133, CD166, and ALDH1 Expression in Small Intestinal Adenocarcinoma.
25670168 Expression of the ALDH1A1 gene is regulated by the WNT signaling pathway and co-occurs with expression of beta-catenin in prostate tumor specimens.
25643237 Suggest that ALDH1 inhibition may not only be able to provide a therapeutic advantage in melanoma treatment, but may also prevent rapid relapse after therapy, as residual tumorigenic cells are fewer and metastatic ability is diminished.
25585687 ALDH1 levels can be used as a useful parameter for pathological evaluation of tissue histology and to predict disease prognosis.
25582316 ALDH1A1 might be a major contributor of ALDH1 activity in breast cancer , since only ALDH1A1 mRNA high expression was found to be significantly correlated to worsen OS for all BC patients.
25502770 ALDH1A1 was predicted to be the main contributor to intratesticular RA formation, but when CRBP1 was present, ALDH1A2 was predicted to be equally important in RA formation as ALDH1A1.
25384215 NOTCH signaling activated ALDH1A1 through the induction of SIRT2, leading to ALDH1A1 deacetylation and enzymatic activation to promote breast CSCs.
25344211 The prognosis of patients with a high level of ALDH1A1 expression was poor compared with that of patients with low levels of expression (P = 0.044). ALDH1A1 is a new mediator for resistance of DLBCL to CHOP.
25270363 Expression of ALDH1 indicates a more aggressive feature of stage III rectal cancer and can stratify stage III rectal cancer into different survival groups
25253129 ALDH1A1 plays an important role in tumor aggressiveness and prognosis, and may act as a promising target for prognostic prediction.
25230277 Findings are consistent with the hypothesis that NEK2 contributes to ALDH1A1-dependent drug resistance in myeloma
25216266 Ovarian cancer cells expressing ALDH1A1 may maintain platinum resistance by altered regulation of cell cycle checkpoint and DNA repair network signaling.
25216223 Our results demonstrate that loss of ALDH1A1expression is an early event in the development of high-grade serous carcinoma
25182808 A single cell methods shows that high expression of ALDH1 along with nuclear TWIST in circulating tumour cells are frequently detected in patients with metastatic breast cancer.
25181420 ALDH1A1 was the most highly expressed isozyme followed by ALDH9A1 in normal and cancerous thyroid tissues.
25148045 prognostic value of ALDH-1, Bmi-1 and Nanog stem cell markers in esophageal squamous cell carcinoma.
25120797 ALDH1 and TGFbeta2 play important roles in the development of breast cancer.
25031716 the ratio of ALDH1A1 level in adjacent mucosa to that in tumor tissues a novel biomarker to reflect the distinct expression patterns of ALDH1A1 for predicting metastasis and prognosis of colorectal cancer
24954508 Data strongly support the role of beta-catenin-regulated ALDH1A1 in the maintenance of ovarian cancer spheroids.
24938375 A systematic review/meta-analysis indicates that ALDH1A1 is a biomarker to predict tumor progression and poor survival of breast cancer patients.
24887554 ALDH1A1, through its function in the retinoic acid metabolism, affects the proliferation and/or early differentiation of stem/progenitor cells and is important for branching morphogenesis.
24865427 Postmortem evaluation of brains of patients with Parkinson's disease revealed a severe reduction of ALDH1A1 expression and neurodegeneration in the ventral ALDH1A1-positive dopaminergic neuron subpopulations.
24786601 these data identified combined expression levels of Aldh1, Survivin, and EpCAM as strong independent prognostic factors, with high hazard ratios, for survival and tumour recurrence in colorectal cancer patients, and therefore reflect tumour aggressiveness.
24770634 Evidence for the prognostic value of ALDH1A1 as a cancer stem cell marker in patients with locally advanced, metastasized HNSCC.
24716927 High level expression of ALDH1A1 was found.
24671051 Expression of Notch1, -2, and -3, CDK2, and CCNE1 was significantly decreased by upregulation of ALDH1A1 in A549 cells, but increased by its interruption in A549s cells.
24670249 Data indicate that aldehyde dehydrogenase 1 (ALDH+) or ALDH+/disialoganglioside (GD2) cells could differentiate into neural cells, adipocytes, osteocytes or chondrocytes.
24599561 Decreased expression of RALDH1 gene is associated with disease progression.
24596390 Combined overexpression of ALDH1 and CD44 are associated with ductal carcinomas in situ in breast cancer.
24519209 High ALDH1 expression is associated with metastasis or recurrence in invasive ductal breast cancer.
24511023 The expression of ALDH1 in patients with vulvar squamous cell carcinoma indicates a significantly better prognosis. There is a trend that the expression of ALDH1 is associated with better histological differentiation.
24485040 High ALDH1A1 expression correlates with papillary thyroid carcinoma.
24464599 The increase of ALDH1A1 and GST activity in Diabetes mellitus seems to be associated with the severity of the disease and might be a compensatory effect against oxidative stress.
24450601 study found that ALDH1, CD44, OCT4 and SOX2 are overexpressed in tongue squamous cell carcinoma
24422956 The 5-year disease-free survival rate of non-small cell lung cancer patients with high aldehyde dehydrogenase 1 (ALDH1) expression levels in their cancer cells was significantly lower than those with a low ALDH1 level
24374552 Findings indicate that ALDH1(+) cells represent a pool of endocrine precursors in the developing human pancreas and that ALDH1 activity is required during endocrine cell differentiation.
24327017 Postoperative ALDH1 independently predicted poor prognosis in patients with RC.
24289252 ALDH1 is upregulated in tumor stem cells isolated from a thoracic myxofibrosarcoma cell line MUG-Myx1.
24285572 Redox probes revealed deficient expression of an apparent 55 kDa protein thiol in Gorlin syndrome patients from independent Gorlin syndrome patients, compared with normal human dermal fibroblasts; proteomics identified this protein as ALDH1A1.
24285422 Increased ALDH1 expression is associated with recurrence in oral squamous cell carcinoma.
24266898 Low ALDH1 expression is associated with high stage and metastatic renal cell carcinoma.
24210755 ALDH1 expression levels correlated with resistance or response to chemoradiation in resectable esophageal cancer patients.
24201124 Our results provide the strong evidence that ALDH1A1(high) cancer stem-like cells contribute to the invasion, metastasis and poor outcome of human esophageal squamous cell carcinoma.
24197864 ALDH1 is an intracellular marker for the identification and isolation of stem-like glioblastoma cells.
24120944 Nodal, a member of TGF-b family, inhibited ALDH1 expression via stimulating TGF-b signaling in uterine endometrioid adenocarcinoma.
24080087 retinoic acid-producing enzyme aldehyde dehydrogenase 1a1 (Aldh1a1) is an oncogene suppressor in specific B cell populations.
24043631 MUC1-C (i) activates a previously unrecognized ERK-->C/EBPbeta-->ALDH1A1 pathway, and (ii) promotes the induction of ALDH activity in breast cancer cells.
24008128 High ALDH1A1 expression in adenoma is associated with metachronous colorectal neoplasia
23969936 ALDH1A1 protein was expressed significantly more frequently and at higher levels in advanced-stage than in low-stage prostate cancer and BPH. Notably, ALDH1A1 positivity was associated with poor survival (P = 0.02) in hormone-naive patients.
23916993 expression of ALDH1 in primary breast tumors or axillary lymph node metastases may be one potential risk factor for poor, long-term outcomes.
23845466 ALDH1 is a prognostic marker for triple-negative breast cancer patients.
23805041 Differential expression of SOD2, ALDH1A1, and MGST1 genes in the anterior lens capsules of patients with pseudoexfoliation syndrome suggest that diseased tissue appears to respond to the previously reported oxidative stress.
23799031 Overall methylation levels in the promoter regions of three genes (ALDH1A1, OPRL1 and RGS19) are elevated in subjects who were exposed to childhood adversity.
23787917 in breast cancer in younger women, ALDH1 was more highly expressed, and it correlated with estrogen receptor negativity. It, however, did not predict survival in this study.
23762304 Higher ALDH1 expression levels in ovary cancer cases are related to poorer prognosis in both serous adenocarcinoma cases and clear cell adenocarcinoma cases.
23759596 ALDH1 within the DCIS lesion can add to the prognostic significance of EZH2, particularly in the context of risk of development of invasive disease.
23707659 Our findings suggested that ALDH1 expression may identify a subgroup of a higher risk of malignant transformation of oral lichen planus
23585015 Detected the expression of ALDH1A1 in 95 cases of clear cell renal cell carcinoma (ccRCC) by immunohistochemistry and correlated it with clinicopathological parameters and prognosis. ALDH1A1 protein showed high expression in 53 of 95 cases of ccRCC.
23483187 A significant correlation between ALDH1 positivity with lower primary tumor differentiation grade.
23465277 Our study suggests that there is a link between ALDH1 and EGFR expression in high-grade serous ovarian carcinoma
23454351 Mitochondrial NAD dependent aldehyde dehydrogenase either from yeast or human replaces yeast cytoplasmic NADP dependent aldehyde dehydrogenase for the aerobic growth of yeast on ethanol.
23434145 Aldehyde dehydrogenase 1, cleaved caspase 3, and cyclooxygenase 2 are useful markers for therapeutic resistance in breast cancer.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of aldehyde dehydrogenase 1 family, member A1 (ALDH1A1) in peptide-treated PBMCs
23332924 ALDH1 expression relates to poor outcome in early stage rectal cancer.
23295229 Due to longer residence time of the NADH in the aldehyde dehydrogenase 1 pocket.
23267077 Benomyl inhibition of aldehyde dehydrogenase leads to the accumulation of 3,4-dihydroxyphenylacetaldehyde, preferential degeneration of dopaminergic neurons, and development of Parkinson disease.
23252868 levels of CD133, CD44, and ALDH1 had independent prognostic value to predict the recurrence of lung adenocarcinoma
23236537 loss of ALDH1A1 expression is suggested to promote carcinogenesis especially in the smoking-related lung adenocarcinomas
23220285 Aldehyde dehydrogenase 1, a functional marker for identifying cancer stem cells in human nasopharyngeal carcinoma.
23132408 ALDH1A1 is a new mediator for resistance of glioblastoma multiforme to temozolomide and a reliable predictor of clinical outcome
23112116 Medullary and metaplastic carcinomas are the two types highly associated with high-grade breast carcinomas, basal-like and claudin-low molecular subtypes, and to the breast cancer stem cell phenotype CD44(+)/CD24(-/low)/ALDH1(+).
23084350 These results show that ALDH1 is expressed in astrocytoma, and that its expression is correlated with pathological grade and patient survival.
23005595 The results indicate that high expression rates of ALDH1 might be a prediction marker for oral squamous cell carcinoma lymph node metastasis.
22938492 increased ALDH1 is inversely correlated with decreased BRCA1 in a series of unselected breast carcinomas.
22930220 ALDH1 expression was higher in stromal components of benign compared with cancerous lesions.
22928012 high ALDH1 activity can be used as a marker for cancer stem cells
22899292 ALDH1 expression and SOX2 expression were associated with a poor prognosis in upper urinary tract urothelial cell carcinoma
22887839 ALDH1A isozymes are markers of human melanoma stem cells and potential therapeutic targets.
22878609 High nuclear ALDH1A1 expression is associated with colon and rectal cancer.
22877687 ALDH1 expression is associated with favorable outcome, in non-small cell lung cancer.
22782852 the expression of cancer stem cell markers ALDH1 and CD133 correlate with a high risk of malignant transformation in a large series of patients with premalignant oral leukoplakia
22725270 expression patterns of ALDH1 and Bmi1 in OE were associated with malignant transformation, suggesting they may be valuable predictors for evaluating risk of oral cancer.
22710732 data show ALDH1A1 expression and activity was higher in gemcitabine (GEM)-resistant MIA PaCa-2 cell line compared to parental cells; in MIA PaCa-2/GR cells, combination of ALDH1A1-siRNA and GEM showed decrease in viability and increase in apoptosis emphasizing importance of ALDH1A1 in intrinsic and acquired GEM resistance
22649953 ALDH-1 expression was higher in tumor tissues of renal cell carcinoma, than normal tissues (p < 0.05).
22617249 High ALDH1A1 expression is associated with aggressive lung cancer.
22608744 Gene expression profiling revealed higher expression of the stem cell related genes PROM1 and NKX3-1 in ALDH1(high) cells than in ALDH1(low) cells.
22591209 promoter polymorphism not associated with alcohol drinking levels
22581680 Statistical analyses did not show any correlation between the pattern of ALDH1 expression and tumor histology, tumor size, or perineural invasion.
22544210 ALDH1 expression is frequent in tumour-associated stromal cells of triple negative breast cancer and is associated with better outcome.
22430847 TGF-beta signalling reduces the expression of ALDH1 and REG4, and the size of the ALDH1+ cell population.
22417385 we provide evidence for ALDH1A1 as a marker of astrocytic differentiation during brain development and of better prognosis in patients suffering from primary glioblastoma.
22407396 Expression of ALDH1 in the axillary lymph node metastases was significantly associated with the disease-free survival in the breast cancer patients.
22380773 the down-regulation of ALDH1A1 mRNA found in substantia nigra tissue of human Parkinson's disease samples
22260461 This study provides further evidence for the stem cell character of ALDH1+ cells, here in benign breast tissue of cancer and non-cancer patients throughout non-lactating adult life, and contributes evidence of benign stromal ALDH1+ cells.
22195027 This result demonstrates the critical role of stress resistance in myogenic cell therapy as well as confirms the role of ALDH as a marker for rapid isolation of murine and human myogenic progenitors for cell therapy.
22131125 ALDH1A1 transcript and protein levels were consistently low in all epithelial subsets from human mammary tissue.
22123295 Data show that aryl hydrocarbon receptor (AhR) activation suppressed mammosphere formation of MCF-7 cells and decreased the proportion of cells with high aldehyde dehydrogenase 1 (ALDH-1) activity.
22115706 ALDH1A1, a putative cancer stem cell marker.
22101256 ALDH1 expression pattern is an independent prognostic marker for survival of T3 N0 M0 G2 colorectal cancer patients.
22098156 demonstrates for the first time that the cancer stem cell marker, ALDH1, is expressed in human esophageal squamous cell carcinoma (ESCC); results indicate the involvement of ALDH1 in the aggressive behavior of ESCC.
22080062 ALDH1A1 could be a useful marker to predict worse clinical outcome after chemotherapy in the neoadjuvant setting with substantial residual cancer burden.
22014057 ALDH1 expression in carcinoma cells is an independent prognostic factor in triple negative breast cancer patients.
22012766 Our study suggested that Msi-1 and/or ALDH1 expression might be closely related to the carcinogenesis, progression, clinical biological behaviors, and prognosis of gallbladder adenocarcinoma.
22005464 the interaction between ALDH status and the ability to establish a stem cell hierarchy in PC3 prostate cancer cells was examined.
21907803 demonstrated that ER-alpha36 positively regulates HER2 expression and the population of ALDH1 positive breast cancer cells, and suggested that non-genomic estrogen signaling mediated by ER-alpha36 is involved in maintenance of breast cancer stem cells
21827011 ALDH1 expression appears only in the undifferentiated cells of glioblastoma.
21804471 Data show that cervical carcinoma contains a small subpopulation of cells that express ALDH1 and may demonstrate a cancer stem cell-like phenotype.
21708005 high expression of ALDH1A1 correlated with proliferation of pancreatic tumour cells; low expression of ALDH1A1 identified as an adverse prognostic marker for survival in pancreatic cancer
21695188 Cell populations enriched for high ALDH activity alone are sufficient for efficient tumor-initiation with enhanced tumorigenic potential relative to CD133(+) and ALDH(low) cell populations in some direct xenograft tumors.
21482329 The presence of RALDH1 in normal lung development (A549 cell line), & the capacity to convert retinol to retinoic acid, indicates that fetal human lung has the ability to regulate the supply of vitamin A from the pseudoglandular stage.
21441790 ALDH 2*1*2 polymorphisms are associated with pancreatic cancer.
21399615 EZH2 and ALDH-1 mark breast epithelium at risk for breast cancer development.
21371077 ALDH1 expression in primary cancer is an independent prognostic factor in node-positive breast cancer patients
21336637 ALDH1 may therefore be a diagnostic marker and a therapeutic target of BRCA1 related breast cancer.
21282737 ALDH activity and CD44 do not appear to identify prostate cance stem cells; however, they do indicate increased tumorigenic and metastatic potential, indicating their potential importance for further exploration.
21231983 High ALDH1 is associated with endometrioid adenocarcinoma.
21118965 Data show that shRNA against NOTCH3 resulted in a significant decrease in ALDH(+) lung cancer cells, commensurate with a reduction in tumor cell proliferation and clonogenicity.
21098716 Data demonstrated that ALDH and CD44 select a subpopulation of cells that are highly tumorigenic.
21045151 Data suggest that A rebalancing of the LIN28/let-7 regulatory loop could be a novel therapeutic strategy to target ALDH1+ cancer stem cells.
20959469 Upregulation of aldehyde dehydrogenase is associated with thyroid cancer.
20959018 aldehyde dehydrogenase 1 has a role in the antitumor effect of the Src inhibitor dasatinib
20889728 The ALDH1A1 subpopulation is associated with chemoresistance and outcome in ovarian cancer patients, and targeting ALDH1A1 sensitizes resistant cells to chemotherapy.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20606680 Prognostic impact of this and other cancer stem cell markers expression in colorectal cancer.
20596639 Sphere-forming cells with elevated ALDH1 are a possible candidate for sarcoma stem cells, possessing strong chemo-resistant capacities.
20585849 The benign stroma of BRCA1 mutation carriers shows higher ALDH1 expression than age-matched controls, implying that BRCA1 may be an (in)direct regulator of mammary stromal ALDH1 expression.
20516116 High aldehyde dehydrogenase activity is associated with tumor-initiating and metastasis-initiating cells in prostate cancer
20422001 a novel cancer stem cell marker, ALDH1 can be used for tumors whose corresponding normal tissues express ALDH1 in relatively restricted or limited levels such as breast, lung, ovarian or colon cancer
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20228222 ALDH1, CD44, and cytokeratin have roles in breast cancer progression
20142235 ALDH1A1 may serve as a useful marker for monitoring the progression of bladder tumo
20019840 ata demonstrate that the overexpression of Twist in breast cells can promote the generation of a cancer stem cell phenotype characterized by the high expression of CD44, little or no expression of CD24, and increased aldehyde dehydrogenase 1 activity.
20010854 ALDH1A1 (aldehyde dehydrogenase 1 family member A1) is a marker for malignant prostate stem cells and predictor of prostate cancer patients' outcome
19911270 high degree of stromal expression of ALDH1 was significantly associated with best disease-free survival as well as a trend for overall survival in breast cancer
19874574 Observational study of gene-disease association. (HuGE Navigator)
19808966 Increased expression of aldehyde dehydrogenase is associated with colon cancer.
19774675 results indicate that targeting up-regulation of 4-hydroxynonenal-detoxifying enzymes like ALDH1A1, possibly by gene therapy, may be a therapeutic strategy for protecting neurons against oxidative damage in neurodegenerative diseases.
19706361 novel ALDH1A1 allele, ALDH1A1*4 , was identified in an Indo-Trinidadian alcoholic with an A inserted at position -554 relative to the translational start site, +1
19706361 Observational study of gene-disease association. (HuGE Navigator)
19703508 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19696793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19478994 Gene duplication event that gave rise to Aldh1a1 and Aldh1a2 was more recent than the duplication event that gave rise to Aldh1a3.
19450560 it is likely that ALDH1 is a specific marker for the cancer stem-like cells of head and neck squamous cell carcinoma.
19447584 ALDH1L1 had higher mean expression levels across regions in all psychiatric groups relative to normal control.
19385968 Breast cancers with ALDH1+ cancer stem cells posses biologically aggressive phenotypes that tend to have a poor prognosis.
19343046 Observational study of gene-disease association. (HuGE Navigator)
19329942 ALDH1 was a favorable prognostic factor in ovarian carcinoma
19296407 lens ALDH1A1(acetaldehyde dehydrogenase 1) is an important defense enzyme against oxidative stress, protecting the eye lens from oxidative damage leading to cataracts
19129088 This study provides further evidence for a role for ALDH1A1 in alcohol consumption behaviour, including problem drinking and possibly alcohol dependence, in Finnish population.
19129088 Observational study of gene-disease association. (HuGE Navigator)
19025616 specific down regulation of ALDH1A1 and ALDH3A1 in Lenti 1+3 cells and in comparison to 12 other ALDH genes detected
19018242 In summary, we have identified a molecular signature that distinguishes NF1-PA from S-PA and found that ALDH1L1 underexpression is associated with aggressive histology and/or biologic behavior
18854779 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18848913 Down-regulation of aldehyde dehydrogenase 1A1 by siRNA transfection reveals its involvement in promoting and inhibiting pancreatic cancer cell lines.
18644979 ALDH, expressed along CD133, can more specifically characterize the tumorigenic liver cancer stem cells population.
18496131 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18450747 analysis of bioactivation of nitroglycerin by purified mitochondrial and cytosolic aldehyde dehydrogenases ALDH1 and ALDH2
18371393 ALDH1 is a marker of normal and malignant human mammary stem cells and a predictor of poor clinical outcome.
18343808 findings show differential expression of aldehyde dehydrogenase 1 between fibroids & myometrium is maintained in cell culture (without endothelial cells), & that this gene is differentially regulated by retinoids in myometrial compared with fibroid cells
18331377 Observational study of gene-disease association. (HuGE Navigator)
18082256 Overexpression of ALDH1A1 inhibits lymphopoiesis and promotes myelopoiesis in murine hematopoietic progenitors to alter cell fate and induce tumor growth
17628022 Retinoic-acid-induced RAR-CAK signaling events appear to proceed intrinsically during granulocytic development of normal primitive hematopoietic cells. ALDH-governed RA availability may mediate this process by initiating RAR-CAK signaling.
17502835 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17286337 Observational study of gene-disease association. (HuGE Navigator)
17286337 promoter polymorphism ALDH1A1*2 may be associated with increased risk for the development of alcohol dependence in Indo-Trinidadians
17222227 ALDH1 can be a dermal biomarker for atopic dermatitis disease.
17175089 ALDH1A1 appears to be the major if not the only enzyme responsible for the oxidation of 3-deoxyglucosone to 2-keto-3-deoxygluconate.
16878979 Random mutagenesis followed by a filter-based screening assay has been used to identify a mutant of human class 1 aldehyde dehydrogenase (ALDH1) that was no longer inhibited by Mg(2+) ions but was activated in their presence.
16857736 Results demonstrate that aldehyde dehydrogenase is a key regulator of hematopoietic stem cell differentiation.
15597079 Observational study of gene-disease association. (HuGE Navigator)
15597079 ALDH1A1*2 may be associated with protection from the development of alcohol and other substance use disorders.
14678778 ALDH1 is strongly and specifically expressed in human mesencephalic dopamine neurons. Low levels of ALDH1 expression correlate with dopamine neuron dysfunction in the two investigated human conditions.
14506398 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
14506398 The promoter region of a gene can influence gene expression, the ALDH1A1 promoter regions were studied to identify polymorphism, to assess their functional significance, and to determine whether they were associated with a risk for developing alcoholism.
12174908 Effect of gene on proliferation arrest in a non-small cell bronchopulmonary cancer line

AA Sequence

MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQA      1 - 70
FQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKI     71 - 140
QGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIK    141 - 210
EAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLA    211 - 280
DADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ    281 - 350
YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR    351 - 420
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVK    421 - 490
TVTVKISQKNS                                                               491 - 501
//

Text Mined References (231)

PMID Year Title
27239845 [Abnormal expression of genes that regulate retinoid metabolism and signaling in non-small-cell lung cancer].
26896768 2016 Aldehyde dehydrogenase 1A1 stabilizes transcription factor Gli2 and enhances the activity of Hedgehog signaling in hepatocellular cancer.
26682730 2015 Prognostic Value of Cancer Stem Cell Marker ALDH1 Expression in Colorectal Cancer: A Systematic Review and Meta-Analysis.
26625750 2015 Clinicopathological Significance of CD133 and ALDH1 Cancer Stem Cell Marker Expression in Invasive Ductal Breast Carcinoma.
26617768 2015 Immunohistochemical evaluation of stem cell markers and signal transducer and activator of transcription 6 (STAT6) in solitary fibrous tumors.
26517640 2015 Cancer stem cell markers in prostate cancer: an immunohistochemical study of ALDH1, SOX2 and EZH2.
26462023 2015 ALDH1A1 mRNA expression in association with prognosis of triple-negative breast cancer.
26449187 2015 ALDH/CD44 identifies uniquely tumorigenic cancer stem cells in salivary gland mucoepidermoid carcinomas.
26398662 2015 Combined expression of aldehyde dehydrogenase 1A1 and ?-catenin is associated with lymph node metastasis and poor survival in breast cancer patients following cyclophosphamide treatment.
26358078 2016 Aldehyde Dehydragenase 1 and Nodal as Significant Prognostic Markers in Colorectal Cancer.
26305673 2015 Stromal expression of ALDH1 in human breast carcinomas indicates reduced tumor progression.
26298632 2015 The clinicopathological and prognostic significance of CD24, CD44, CD133, ALDH1 expressions in invasive ductal carcinoma of the breast: CD44/CD24 expression in breast cancer.
26254374 2015 Prognostic Impact of ALDH1 Expression in Transitional Cell Carcinoma of the Renal Pelvis.
26230297 2015 Clinicopathological significance of ALDH1A1 in lung, colorectal, and breast cancers: a meta-analysis.
26175266 2015 Stem cell biomarker ALDH1A1 in breast cancer shows an association with prognosis and clinicopathological variables that is highly cut-off dependent.
26160842 2015 ALDH1A1-overexpressing cells are differentiated cells but not cancer stem or progenitor cells in human hepatocellular carcinoma.
26148881 2015 The expression of aldehyde dehydrogenase 1 (ALDH1) in ovarian carcinomas and its clinicopathological associations: a retrospective study.
26130650 2015 IL6/JAK1/STAT3 Signaling Blockade in Endometrial Cancer Affects the ALDHhi/CD126+ Stem-like Component and Reduces Tumor Burden.
26080709 2016 Macrophage and dendritic cell subsets in IBD: ALDH+ cells are reduced in colon tissue of patients with ulcerative colitis regardless of inflammation.
26070788 2015 Aldehyde dehydrogenase 1 expression correlates with the invasion of breast cancer.
26063415 2015 Proliferation rate and breast cancer subtype, but not ALDH1 expression, predict pathological response to neoadjuvant chemotherapy in locally advanced breast cancer.
26046383 2015 Differential Expression of Cancer Stem Cell Markers ALDH1 and CD133 in Various Lung Cancer Subtypes.
25999351 2015 Accumulation of ALDH1-positive cells after neoadjuvant chemotherapy predicts treatment resistance and prognosticates poor outcome in ovarian cancer.
25963795 2015 Clinicopathological significance of cancer stem-like cell markers in high-grade neuroendocrine carcinoma of the lung.
25921687 2015 ALDH1 Expression and the Prognosis of Lung Cancer: A Systematic Review and Meta-Analysis.
25881507 2015 The role of LGR5 and ALDH1A1 in non-small cell lung cancer: Cancer progression and prognosis.
25864109 2015 ALDH1 might influence the metastatic capability of HeLa cells.
25843691 2015 Aldehyde dehydrogenase 1 (ALDH1) expression is associated with a poor prognosis of bladder cancer.
25793304 2015 Identification of active retinaldehyde dehydrogenase isoforms in the postnatal human eye.
25710579 Prognostic Significance of CD44v6, CD133, CD166, and ALDH1 Expression in Small Intestinal Adenocarcinoma.
25670168 2015 Aldehyde Dehydrogenase Is Regulated by ?-Catenin/TCF and Promotes Radioresistance in Prostate Cancer Progenitor Cells.
25643237 2015 Targeting ALDH1 to decrease tumorigenicity, growth and metastasis of human melanoma.
25585687 2015 Aldehyde dehydrogenase 1: a specific cancer stem cell marker for human colorectal carcinoma.
25582316 2015 Distinct prognostic values of ALDH1 isoenzymes in breast cancer.
25502770 2015 Importance of ALDH1A enzymes in determining human testicular retinoic acid concentrations.
25450233 2015 Development of a high-throughput in vitro assay to identify selective inhibitors for human ALDH1A1.
25384215 2014 NOTCH-induced aldehyde dehydrogenase 1A1 deacetylation promotes breast cancer stem cells.
25344211 2014 ALDH1A1 mediates resistance of diffuse large B cell lymphoma to the CHOP regimen.
25270363 2015 ALDH1 is a prognostic factor for patients treated with neoadjuvant chemoradiotherapy and radical resection for stage III rectal cancer.
25253129 2014 ALDH1A1 overexpression is associated with the progression and prognosis in gastric cancer.
25230277 2014 NEK2 mediates ALDH1A1-dependent drug resistance in multiple myeloma.
25216266 2014 ALDH1A1 maintains ovarian cancer stem cell-like properties by altered regulation of cell cycle checkpoint and DNA repair network signaling.
25216223 2015 Loss of ALDH1A1 expression is an early event in the pathogenesis of ovarian high-grade serous carcinoma.
25182808 2014 Co-expression of putative stemness and epithelial-to-mesenchymal transition markers on single circulating tumour cells from patients with early and metastatic breast cancer.
25181420 2015 Studies on expression of aldehyde dehydrogenase in normal and cancerous tissues of thyroids.
25148045 2014 A retrospective review of the prognostic value of ALDH-1, Bmi-1 and Nanog stem cell markers in esophageal squamous cell carcinoma.
25120797 2014 Expression of ALDH1 and TGF?2 in benign and malignant breast tumors and their prognostic implications.
25031716 2014 Distinct patterns of ALDH1A1 expression predict metastasis and poor outcome of colorectal carcinoma.
24954508 2015 ?-Catenin-regulated ALDH1A1 is a target in ovarian cancer spheroids.
24938375 2014 ALDH1A1 expression correlates with clinicopathologic features and poor prognosis of breast cancer patients: a systematic review and meta-analysis.
24887554 2014 Aldehyde dehydrogenase and estrogen receptor define a hierarchy of cellular differentiation in the normal human mammary epithelium.
24865427 2014 Aldehyde dehydrogenase 1 defines and protects a nigrostriatal dopaminergic neuron subpopulation.
24786601 2014 Clinical prognostic value of combined analysis of Aldh1, Survivin, and EpCAM expression in colorectal cancer.
24770634 2014 Prognostic significance of ALDH1A1-positive cancer stem cells in patients with locally advanced, metastasized head and neck squamous cell carcinoma.
24716927 2014 ALDH1 in combination with CD44 as putative cancer stem cell markers are correlated with poor prognosis in urothelial carcinoma of the urinary bladder.
24671051 2014 ALDH maintains the stemness of lung adenoma stem cells by suppressing the Notch/CDK2/CCNE pathway.
24670249 2014 Malignant phyllodes tumors display mesenchymal stem cell features and aldehyde dehydrogenase/disialoganglioside identify their tumor stem cells.
24599561 2014 Altered expression of multiple genes involved in retinoic acid biosynthesis in human colorectal cancer.
24596390 2014 Co-expression of stem cell markers ALDH1 and CD44 in non-malignant and neoplastic lesions of the breast.
24519209 2014 ALDH1 is a better clinical indicator for relapse of invasive ductal breast cancer than the CD44+/CD24- phenotype.
24511023 2014 Aldehyde dehydrogenase-1 predicts favorable prognosis in patients with vulvar squamous cell carcinoma.
24485040 2014 High ALDH1A1 expression correlates with poor survival in papillary thyroid carcinoma.
24464599 2014 Blood ALDH1 and GST activity in diabetes type 2 and its correlation with glycated hemoglobin.
24450601 2014 Correlation of ALDH1, CD44, OCT4 and SOX2 in tongue squamous cell carcinoma and their association with disease progression and prognosis.
24422956 2013 Aldehyde dehydrogenase 1 expression in cancer cells could have prognostic value for patients with non-small cell lung cancer who are treated with neoadjuvant therapy: identification of prognostic microenvironmental factors after chemoradiation.
24374552 2014 Aldehyde dehydrogenase 1 activity in the developing human pancreas modulates retinoic acid signalling in mediating islet differentiation and survival.
24327017 2014 ALDH1 is an independent prognostic factor for patients with stages II-III rectal cancer after receiving radiochemotherapy.
24289252 2013 The novel myxofibrosarcoma cell line MUG-Myx1 expresses a tumourigenic stem-like cell population with high aldehyde dehydrogenase 1 activity.
24285572 2015 Deficient expression of aldehyde dehydrogenase 1A1 is consistent with increased sensitivity of Gorlin syndrome patients to radiation carcinogenesis.
24285422 2014 In vitro and in vivo expression of aldehyde dehydrogenase 1 in oral squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24266898 2013 Aldehyde dehydrogenase 1 expression in primary and metastatic renal cell carcinoma: an immunohistochemistry study.
24210755 2014 ALDH-1 expression levels predict response or resistance to preoperative chemoradiation in resectable esophageal cancer patients.
24201124 2014 ALDH1A1 defines invasive cancer stem-like cells and predicts poor prognosis in patients with esophageal squamous cell carcinoma.
24197864 2014 Hypoxia upregulates aldehyde dehydrogenase isoform 1 (ALDH1) expression and induces functional stem cell characteristics in human glioblastoma cells.
24120944 2013 Inhibitory effect of Nodal on the expression of aldehyde dehydrogenase 1 in endometrioid adenocarcinoma of uterus.
24080087 2013 Aldehyde dehydrogenase-1a1 induces oncogene suppressor genes in B cell populations.
24043631 2013 MUC1-C oncoprotein activates ERK?C/EBP? signaling and induction of aldehyde dehydrogenase 1A1 in breast cancer cells.
24008128 2013 Colorectal adenoma stem-like cell populations: associations with adenoma characteristics and metachronous colorectal neoplasia.
23969936 2013 Characterization and clinical relevance of ALDHbright populations in prostate cancer.
23916993 2013 The expression of aldehyde dehydrogenase 1 in invasive primary breast tumors and axillary lymph node metastases is associated with poor clinical prognosis.
23845466 2013 Novel prognostic markers for patients with triple-negative breast cancer.
23805041 2013 Quantitative analysis of SOD2, ALDH1A1 and MGST1 messenger ribonucleic acid in anterior lens epithelium of patients with pseudoexfoliation syndrome.
23799031 2013 Profiling of childhood adversity-associated DNA methylation changes in alcoholic patients and healthy controls.
23787917 2013 ALDH1 expression is enriched in breast cancers arising in young women but does not predict outcome.
23762304 2013 ALDH1-high ovarian cancer stem-like cells can be isolated from serous and clear cell adenocarcinoma cells, and ALDH1 high expression is associated with poor prognosis.
23759596 2013 EZH2 and ALDH1 expression in ductal carcinoma in situ: complex association with recurrence and progression to invasive breast cancer.
23707659 2013 Aldehyde dehydrogenase 1 expression correlated with malignant potential of oral lichen planus.
23585015 2013 Increased expression of ALDH1A1 protein is associated with poor prognosis in clear cell renal cell carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23483187 2013 ALDH1-positive cancer stem-like cells are enriched in nodal metastases of oropharyngeal squamous cell carcinoma independent of HPV status.
23465277 2013 Aldehyde dehydrogenase 1/epidermal growth factor receptor coexpression is characteristic of a highly aggressive, poor-prognosis subgroup of high-grade serous ovarian carcinoma.
23454351 2013 Mitochondrial NAD dependent aldehyde dehydrogenase either from yeast or human replaces yeast cytoplasmic NADP dependent aldehyde dehydrogenase for the aerobic growth of yeast on ethanol.
23434145 2013 Molecular markers of therapeutic resistance in breast cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23332924 2013 ALDH1 expression indicates chemotherapy resistance and poor outcome in node-negative rectal cancer.
23295229 2013 Fluorescence lifetime analysis and effect of magnesium ions on binding of NADH to human aldehyde dehydrogenase 1.
23267077 2013 Aldehyde dehydrogenase inhibition as a pathogenic mechanism in Parkinson disease.
23252868 2012 Expression of the potential cancer stem cell markers, CD133, CD44, ALDH1, and ?-catenin, in primary lung adenocarcinoma--their prognostic significance.
23236537 2013 Downregulation of ALDH1A1 expression in non-small cell lung carcinomas--its clinicopathologic and biological significance.
23220285 2013 Aldehyde dehydrogenase 1, a functional marker for identifying cancer stem cells in human nasopharyngeal carcinoma.
23132408 2012 Aldehyde dehydrogenase 1A1--a new mediator of resistance to temozolomide in glioblastoma.
23112116 2013 Cancer stem cells markers CD44, CD24 and ALDH1 in breast cancer special histological types.
23084350 2012 ALDH1 expression is correlated with pathologic grade and poor clinical outcome in patients with astrocytoma.
23005595 2012 High expression of ALDH1 and SOX2 diffuse staining pattern of oral squamous cell carcinomas correlates to lymph node metastasis.
22938492 2012 High expression of stem cell marker ALDH1 is associated with reduced BRCA1 in invasive breast carcinomas.
22930220 2013 Expression of aldehyde dehydrogenase 1 as a marker of mammary stem cells in benign and malignant breast lesions of Ghanaian women.
22928012 2012 Aldehyde dehydrogenase 1, a potential marker for cancer stem cells in human sarcoma.
22899292 2013 Prognostic impact of the expression of ALDH1 and SOX2 in urothelial cancer of the upper urinary tract.
22887839 2012 ALDH1A isozymes are markers of human melanoma stem cells and potential therapeutic targets.
22878609 2012 Expression analysis of aldehyde dehydrogenase 1A1 (ALDH1A1) in colon and rectal cancer in association with prognosis and response to chemotherapy.
22877687 2012 Measurement of aldehyde dehydrogenase 1 expression defines a group with better prognosis in patients with non-small cell lung cancer.
22782852 2013 Expression patterns of cancer stem cell markers ALDH1 and CD133 correlate with a high risk of malignant transformation of oral leukoplakia.
22725270 2013 Expression of cancer stem cell markers ALDH1 and Bmi1 in oral erythroplakia and the risk of oral cancer.
22710732 2012 Aldehyde dehydrogenase 1A1 confers intrinsic and acquired resistance to gemcitabine in human pancreatic adenocarcinoma MIA PaCa-2 cells.
22649953 2012 Stem cell markers aldehyde dehydrogenase type 1 and nestin expressions in renal cell cancer.
22617249 2012 Aldehyde dehydrogenase 1A1 possesses stem-like properties and predicts lung cancer patient outcome.
22608744 2012 Gene expression profiles of prostate cancer stem cells isolated by aldehyde dehydrogenase activity assay.
22591209 2013 Association of the ALDH1A1*2 promoter polymorphism with alcohol phenotypes in young adults with or without ALDH2*2.
22581680 2013 ALDH1 immunohistochemical expression and its significance in salivary adenoid cystic carcinoma.
22544210 2012 Prognostic impact of the cancer stem cell related markers ALDH1 and EZH2 in triple negative and basal-like breast cancers.
22430847 2012 Coordinated expression of REG4 and aldehyde dehydrogenase 1 regulating tumourigenic capacity of diffuse-type gastric carcinoma-initiating cells is inhibited by TGF-?.
22417385 2012 ALDH1A1 is a marker of astrocytic differentiation during brain development and correlates with better survival in glioblastoma patients.
22407396 2014 Expression of ALDH1 in axillary lymph node metastases is a prognostic factor of poor clinical outcome in breast cancer patients with 1-3 lymph node metastases.
22380773 2013 Identification of aldehyde dehydrogenase 1A1 modulators using virtual screening.
22260461 2012 Distribution of aldehyde dehydrogenase 1-positive stem cells in benign mammary tissue from women with and without breast cancer.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22195027 2011 Murine and human myogenic cells identified by elevated aldehyde dehydrogenase activity: implications for muscle regeneration and repair.
22131125 2012 Aldehyde dehydrogenase activity is a biomarker of primitive normal human mammary luminal cells.
22123295 2012 Activation of the aryl hydrocarbon receptor represses mammosphere formation in MCF-7 cells.
22115706 2012 Hedgehog signaling pathway molecules and ALDH1A1 expression in early-stage non-small cell lung cancer.
22101256 2012 The expression pattern of aldehyde dehydrogenase 1 (ALDH1) is an independent prognostic marker for low survival in colorectal tumors.
22098156 2012 Cancer stem cell marker ALDH1 expression is associated with lymph node metastasis and poor survival in esophageal squamous cell carcinoma: a study from high incidence area of northern China.
22080062 2012 Aldehyde dehydrogenase 1A1 expression in breast cancer is associated with stage, triple negativity, and outcome to neoadjuvant chemotherapy.
22014057 2011 Aldehyde dehydrogenase 1 expression predicts poor prognosis in triple-negative breast cancer.
22012766 Identification of musashi-1 and ALDH1 as carcinogenesis, progression, and poor-prognosis related biomarkers for gallbladder adenocarcinoma.
22005464 2011 Aldehyde dehydrogenase activity selects for the holoclone phenotype in prostate cancer cells.
21907803 2011 A positive cross-regulation of HER2 and ER-?36 controls ALDH1 positive breast cancer cells.
21827011 2011 [Adherent culture of CD133+ cells in glioblastomas and expression of ADLH1].
21804471 2011 The expression of ALDH1 in cervical carcinoma.
21708005 2011 Low expression of aldehyde dehydrogenase 1A1 (ALDH1A1) is a prognostic marker for poor survival in pancreatic cancer.
21695188 2011 ALDH activity selectively defines an enhanced tumor-initiating cell population relative to CD133 expression in human pancreatic adenocarcinoma.
21482329 2011 [A study of the metabolic pathways of vitamin A in the fetal human lung].
21441790 2011 Polymorphisms and pancreatic cancer risk: a meta-analysis.
21399615 2011 EZH2 and ALDH-1 mark breast epithelium at risk for breast cancer development.
21371077 2011 Aldehyde dehydrogenase 1 expression is a predictor of poor prognosis in node-positive breast cancers: a long-term follow-up study.
21336637 2011 Expression of the stem cell marker ALDH1 in BRCA1 related breast cancer.
21282737 ALDH activity indicates increased tumorigenic cells, but not cancer stem cells, in prostate cancer cell lines.
21269460 2011 Initial characterization of the human central proteome.
21231983 2011 Expression of aldehyde dehydrogenase 1 (ALDH1) in endometrioid adenocarcinoma and its clinical implications.
21118965 2010 Aldehyde dehydrogenase activity selects for lung adenocarcinoma stem cells dependent on notch signaling.
21098716 2010 Endothelial cell-initiated signaling promotes the survival and self-renewal of cancer stem cells.
21045151 2010 Double-negative feedback loop between reprogramming factor LIN28 and microRNA let-7 regulates aldehyde dehydrogenase 1-positive cancer stem cells.
20959469 2010 Tumorigenic and metastatic activity of human thyroid cancer stem cells.
20959018 2010 Preferential antitumor effect of the Src inhibitor dasatinib associated with a decreased proportion of aldehyde dehydrogenase 1-positive cells in breast cancer cells of the basal B subtype.
20889728 2010 Targeting aldehyde dehydrogenase cancer stem cells in ovarian cancer.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20606680 2010 Prognostic impact of the expression of putative cancer stem cell markers CD133, CD166, CD44s, EpCAM, and ALDH1 in colorectal cancer.
20596639 2010 Possible involvement of stem-like populations with elevated ALDH1 in sarcomas for chemotherapeutic drug resistance.
20585849 2010 Expression of the stem cell marker ALDH1 in the normal breast of BRCA1 mutation carriers.
20516116 2010 High aldehyde dehydrogenase activity identifies tumor-initiating and metastasis-initiating cells in human prostate cancer.
20422001 2010 Distinct expression levels and patterns of stem cell marker, aldehyde dehydrogenase isoform 1 (ALDH1), in human epithelial cancers.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20228222 2010 In situ identification of putative cancer stem cells by multiplexing ALDH1, CD44, and cytokeratin identifies breast cancer patients with poor prognosis.
20142235 2010 Aldehyde dehydrogenase 1 A1-positive cell population is enriched in tumor-initiating cells and associated with progression of bladder cancer.
20019840 2009 Twist modulates breast cancer stem cells by transcriptional regulation of CD24 expression.
20010854 2010 ALDH1A1 is a marker for malignant prostate stem cells and predictor of prostate cancer patients' outcome.
19911270 2010 Prognostic impact of ALDH1 in breast cancer: a story of stem cells and tumor microenvironment.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19808966 2009 Aldehyde dehydrogenase-expressing colon stem cells contribute to tumorigenesis in the transition from colitis to cancer.
19774675 2010 Overexpression of aldehyde dehydrogenase 1A1 reduces oxidation-induced toxicity in SH-SY5Y neuroblastoma cells.
19706361 2009 Identification of a novel cytosolic aldehyde dehydrogenase allele, ALDH1A1*4.
19703508 2009 Positive association between ALDH1A2 and schizophrenia in the Chinese population.
19696793 2009 Association study of genetic polymorphism in ABCC4 with cyclophosphamide-induced adverse drug reactions in breast cancer patients.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19478994 2009 Consequences of lineage-specific gene loss on functional evolution of surviving paralogs: ALDH1A and retinoic acid signaling in vertebrate genomes.
19450560 2009 Aldehyde dehydrogenase 1 is a putative marker for cancer stem cells in head and neck squamous cancer.
19447584 2009 Subcortical oligodendrocyte- and astrocyte-associated gene expression in subjects with schizophrenia, major depression and bipolar disorder.
19385968 2009 Stem cell marker aldehyde dehydrogenase 1-positive breast cancers are characterized by negative estrogen receptor, positive human epidermal growth factor receptor type 2, and high Ki67 expression.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19329942 2009 ALDH1 expression correlates with favorable prognosis in ovarian cancers.
19296407 2009 Molecular cloning and oxidative modification of human lens ALDH1A1: implication in impaired detoxification of lipid aldehydes.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19129088 2008 The role of aldehyde dehydrogenase-1 (ALDH1A1) polymorphisms in harmful alcohol consumption in a Finnish population.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19025616 2008 ALDH isozymes downregulation affects cell growth, cell motility and gene expression in lung cancer cells.
19018242 2008 Gene expression profiling of NF-1-associated and sporadic pilocytic astrocytoma identifies aldehyde dehydrogenase 1 family member L1 (ALDH1L1) as an underexpressed candidate biomarker in aggressive subtypes.
18854779 2008 Relations between polymorphisms in drug-metabolising enzymes and toxicity of chemotherapy with cyclophosphamide, thiotepa and carboplatin.
18848913 2008 Aldehyde dehydrogenase 1A1 and gelsolin identified as novel invasion-modulating factors in conditioned medium of pancreatic cancer cells.
18644979 2008 Aldehyde dehydrogenase discriminates the CD133 liver cancer stem cell populations.
18496131 2008 Influence of polymorphisms of drug metabolizing enzymes (CYP2B6, CYP2C9, CYP2C19, CYP3A4, CYP3A5, GSTA1, GSTP1, ALDH1A1 and ALDH3A1) on the pharmacokinetics of cyclophosphamide and 4-hydroxycyclophosphamide.
18450747 2008 Bioactivation of nitroglycerin by purified mitochondrial and cytosolic aldehyde dehydrogenases.
18371393 2007 ALDH1 is a marker of normal and malignant human mammary stem cells and a predictor of poor clinical outcome.
18343808 2008 Retinoids regulate genes involved in retinoic acid synthesis and transport in human myometrial and fibroid smooth muscle cells.
18331377 2008 Association of ADH and ALDH genes with alcohol dependence in the Irish Affected Sib Pair Study of alcohol dependence (IASPSAD) sample.
18082256 2008 Overexpression of stem cell associated ALDH1A1, a target of the leukemogenic transcription factor TLX1/HOX11, inhibits lymphopoiesis and promotes myelopoiesis in murine hematopoietic progenitors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17628022 2007 Intrinsic retinoic acid receptor alpha-cyclin-dependent kinase-activating kinase signaling involves coordination of the restricted proliferation and granulocytic differentiation of human hematopoietic stem cells.
17502835 2007 Genetic polymorphisms of CYP2B6 affect the pharmacokinetics/pharmacodynamics of cyclophosphamide in Japanese cancer patients.
17286337 2007 Association of ALDH1 promoter polymorphisms with alcohol-related phenotypes in Trinidad and Tobago.
17222227 2007 Detection of down-regulated acetaldehyde dehydrogenase 1 in atopic dermatitis patients by two-dimensional electrophoresis.
17175089 2007 Identification of 3-deoxyglucosone dehydrogenase as aldehyde dehydrogenase 1A1 (retinaldehyde dehydrogenase 1).
16878979 2006 Selective alteration of the rate-limiting step in cytosolic aldehyde dehydrogenase through random mutagenesis.
16857736 2006 Inhibition of aldehyde dehydrogenase and retinoid signaling induces the expansion of human hematopoietic stem cells.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15597079 2004 Association of ALDH1 promoter polymorphisms with alcohol-related phenotypes in southwest California Indians.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14678778 2003 ALDH1 mRNA: presence in human dopamine neurons and decreases in substantia nigra in Parkinson's disease and in the ventral tegmental area in schizophrenia.
14506398 2003 Evaluation of aldehyde dehydrogenase 1 promoter polymorphisms identified in human populations.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12174908 Effect of four genes (ALDH1, NRF1, JAM and KBL) on proliferation arrest in a non-small cell bronchopulmonary cancer line.
12081471 2002 Structural aspects of aldehyde dehydrogenase that influence dimer-tetramer formation.
9723161 Human ocular aldehyde dehydrogenase isozymes: distribution and properties as major soluble proteins in cornea and lens.
9240474 1997 Cloning of a cDNA encoding a constitutively expressed rat liver cytosolic aldehyde dehydrogenase.
9166904 1997 The cytosolic aldehyde dehydrogenase gene (Aldh1) is developmentally expressed in Leydig cells.
8493914 1993 Biological role of human cytosolic aldehyde dehydrogenase 1: hormonal response, retinal oxidation and implication in testicular feminization.
8214422 1993 Cloning and expression of the full-length cDNAS encoding human liver class 1 and class 2 aldehyde dehydrogenase.
6723659 1984 Aldehyde dehydrogenase from human liver. Primary structure of the cytoplasmic isoenzyme.
6427007 1984 Acetyl-blocked N-terminal structures of sorbitol and aldehyde dehydrogenases.
4015840 Biochemical genetic analysis of human and rodent aldehyde dehydrogenase (ALDH).
4015823 Molecular abnormality and cDNA cloning of human aldehyde dehydrogenases.
3676276 1987 Active site of human liver aldehyde dehydrogenase.
3397064 1988 Regional localization of the human genes for aldehyde dehydrogenase-1 and aldehyde dehydrogenase-2.
3013004 1986 Chromosomal assignment of the genes for human aldehyde dehydrogenase-1 and aldehyde dehydrogenase-2.
2987944 1985 Cloning of cDNAs for human aldehyde dehydrogenases 1 and 2.
2776714 1989 Aldehyde dehydrogenase from human erythrocytes: structural relationship to the liver cytosolic isozyme.
2591967 1989 Genomic structure of the human cytosolic aldehyde dehydrogenase gene.
1709013 1991 The 56 kDa androgen binding protein is an aldehyde dehydrogenase.
730161 1978 Isozyme variations in acetaldehyde dehydrogenase (e.c.1.2.1.3) in human tissues.
224930 1979 Purification and partial characterization of aldehyde dehydrogenase from human erythrocytes.