Property Summary

NCBI Gene PubMed Count 122
PubMed Score 299.94
PubTator Score 268.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Rheumatoid Arthritis 1.400 1.7e-02
astrocytic glioma 2.200 6.8e-03
oligodendroglioma 1.900 1.6e-02
esophageal adenocarcinoma 1.600 5.0e-02
psoriasis -2.700 1.5e-04
cutaneous lupus erythematosus -1.100 3.2e-02
posterior fossa group B ependymoma -2.000 5.7e-06
group 4 medulloblastoma -4.100 7.2e-06
glioblastoma -1.100 1.8e-02
medulloblastoma, large-cell -1.700 3.5e-02
tuberculosis -2.800 7.8e-06
colon cancer 1.300 1.8e-02
lung cancer -1.200 1.3e-04
active Crohn's disease 1.890 1.8e-03
Breast cancer 3.300 2.5e-02
interstitial cystitis -1.900 6.0e-04
pilocytic astrocytoma 1.500 3.7e-05
invasive ductal carcinoma 2.100 5.9e-03
nasopharyngeal carcinoma -1.400 1.9e-02
progressive supranuclear palsy -1.500 7.0e-03
ductal carcinoma in situ 1.600 4.6e-02
ulcerative colitis 1.400 1.5e-05
ovarian cancer -2.300 2.6e-10
chronic rhinosinusitis -1.108 2.5e-02
cystic fibrosis and chronic rhinosinusit... -1.061 4.1e-02

 GO Function (1)

Protein-protein Interaction (3)

Gene RIF (99)

PMID Text
26146185 The binding sites on CD6 and CD166 have been characterized to show that a SNP in CD6 causes glycosylation that hinders the CD6/CD166 interaction.
26134500 High ALCAM expression in melanoma cells of the primary tumor may indicate a more invasive phenotype. Low expression of ALCAM in regional lymph node metastases is a feature associated with unfavorable prognosis in patients with cutaneous melanoma.
26004137 a model that CD166 regulates MCAM through a signaling flow from activation of PI3K/AKT and c-Raf/MEK/ERK signaling to the inhibition of potential MCAM ubiquitin E3 ligases, betaTrCP and Smurf1
25987048 High ALCAM expression is associated with Invasive Cholangiocarcinoma.
25710579 Prognostic Significance of CD44v6, CD133, CD166, and ALDH1 Expression in Small Intestinal Adenocarcinoma.
25562819 The Serum CD166 is a novel diagnostic tumor marker for hepatocellular carcinoma (HCC).
25539763 Differentially expressed/regulated cancer-related genes upon miR-125b expression along with the significant increase of ALCAM
25472586 an overexpression of CD166 was detected in the benign and malignant salivary gland tumors and its expression in the malignant tumor was associated with the aggressive behavior and tumor progression.
25420915 CD14(+)CD16(+) monocytes selectively transmigrated across our BBB model as a result of their increased JAM-A and ALCAM expression.
25395097 Overexpression of activated leukocute cell adhesion molecule in gastric cancer is associated with advanced stages and poor prognosis and miR-9 deregulation
25270339 ALCAM is generally expressed in normal and cancerous breast epithelium and that a marked reduction of ALCAM expression characterizes a subset of breast cancer patients with adverse tumor characteristics and unfavorable clinical outcome.
25255861 Low expression of ALCAM at sites of cell-cell contact in primary breast cancer tumors regardless of differentiation, size and lymph node involvement may contribute to the more aggressive phenotype of breast cancer among African-American women.
25094049 CD166 affected-CD44 expression is dependent of transcription via blocking NF-kappaB pathway. On the contrary, CD44 promoted up-regulation of CD166 mRNA and protein.
24966904 Migration of CD166 positive progenitor cells to sites of cartilage damage may be directed by regulation of DCC/CREB signaling.
24891117 Data indicate that the CD166/AKT axis modulates tumorigenesis via promotion of phosphorylation and facilitation of degradation, ubiquitination and cytosolic accumulation of FOXO proteins in liver cancer cells.
24710410 By directly targeting the Rho GDP dissociation inhibitor alpha (RhoGDI1) and activated leukocyte cell adhesion molecule (ALCAM).
24708484 These show high p21 and CD166 expression at the pretreatment biopsy were associated with tumor regression and poor prognosis in patients treated with 5-FU based chemoradiotherapy
24662291 ALCAM stably interacts with actin by binding to syntenin-1 and ezrin.
24562769 miR126-5p is a functional, endothelial-enriched microRNA that participates in the control of leucocyte trafficking by regulating the expression of ALCAM and SetD5.
24501004 The expression of CD166 using immunohistochemistry in a large cohort of non-small cell lung cancer patients , was evaluated.
24496453 Authors propose a framework for how ALCAMs contribute to DC-T-cell adhesion, stabilize DC-T-cell contacts and form a mechanical link between CD6 and the actin cortex to strengthen cell adhesion at the immunological synapse.
24487095 An antibody drug conjugate was generated recognizing the CD166 antigen which was found to be strongly up-regulated in all AML cell lines and AML blasts of some patients
24482231 this work summarizes a novel link between CD166 and YAP, explores the interplay among related important signaling pathways, and may lead to more effective therapeutic strategies for liver cancer.
24385212 ALCAM expression and shedding is elevated in response to TGF-beta signaling.
24311639 High ALCAM expression is associated with brain metastasis.
24044434 Data indicate that arylsulfonamide inhibited ADAM-17 with selectivity, and maintained inhibitory properties on sALCAM shedding.
23940674 CD166 expression indicate advanced tumor load category and node-positive status in colorectal cancer specifically. [Meta-analysis]
23922698 The entry of HIV infected and uninfected CD14(+)CD16(+) monocytes into the brain was facilitated by significantly increased surface JAM-A, ALCAM, CD99, and PECAM-1, as compared to CD14(+) cells that are CD16 negative.
23903875 Patients whose head and neck squamous cell carcinoma tumors expressed high levels of CD166 had a significantly poorer clinical outcome than those whose tumors expressed low levels of CD166.
23840677 Loss of E-cadherin and beta-catenin with cytoplasmic ALCAM accumulation may play pivotal role in oral cancer development and progression.
23539446 retention of intact ALCAM was associated with improved survival
23507476 The present study is the first to report evidence of the association of rs6437585 ALCAM polymorphism with risk and progression of multiple sclerosis
23169771 novel role for ALCAM in stabilizing LEC-LEC interactions and in the organization and function of the LV network.
23169448 Serum sALCAM levels were significantly higher in epithelial ovarian cancer.
23148625 ALCAM can be taken forward for analysis in sera of patients with thyroid carcinoma to determine its applicability as a minimally invasive serum biomarker for TC aggressiveness and patient disease-free survival.
23052204 ALCAM directly associates with the tetraspanin CD9 in a protein complex on the leukocyte surface that also includes the metalloproteinase ADAM17.
22880034 The presence of CD166 on prostate stem/progenitors and castration resistant sub-populations suggest that it is a cell surface molecule with the potential for targeted delivery of human prostate cancer therapeutics.
22745734 Data suggested role for ALCAM in the regulation of adherens junctions, and also suggest a mechanism by which ALCAM might differentially enhance or decrease invasiveness.
22745698 ALCAM is expressed in the majority of PAC lesions, but statistical analysis revealed no association with clinical or pathological data.
22722789 High ALCAM expression is associated with malignant mesothelioma.
22704111 The nearest gene to these 2 single nucleotide polymorphisms is ALCAM. Genetic association results at these loci were similar on univariate and multivariate analysis. No candidate genes met the criteria for statistical significance.
22555284 sALCAM levels differed between patients and healthy controls (median 24.2 vs. 18.9 ng/ml, p < 0.001).
22482754 positive prognostic marker for overall survival of colorectal cancer patients
22304788 our findings indicate that activated leukocyte adhesion molecule expression levels in gliomas are probably linked to other mechanisms than its supposed role as regulator of matrix metalloproteinase 2.
22166264 High ALCAM expression is associated with glioblastoma invasion.
22130902 Increased expression of CD44, CD166 and CD133 from normal mucosa samples to adenoma and carcinoma was linked to tumor progression in tumors of the ampulla of Vater.
22082156 Knockdown of activated leukocyte cell adhesion molecule (ALCAM) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21935604 Two SNPs in the ALCAM gene were associated with breast cancer-specific survival.
21915031 We sought to determine if ezrin, KBA.62, p-Akt, CD166, and nestin, may be helpful in distinguishing melanoma from nevi and atypical melanocytic lesions
21858815 increased ALCAM expression found in majority of esophageal cancer(EC)lesions; expression was not associated with histopathology parameters except tumor grading; ALCAM-positive patients had worse survival; increased ALCAM expression in primary malignant lesions and elevated serum-ALCAM level are prognostic markers of poor survival in EC
21816001 The impact of ALCAM in wound healing may thus be somewhat due to its impact on cell migration and growth.
21757661 ALCAM levels measured at admission of acute ischemic stroke are associated with long-term mortality.
21683980 Activated leukocyte cell adhesion molecule protein (CD166) is almost always expressed in prostate cancer and decreased levels of activated leukocyte cell adhesion molecule expression may lead to an aggressive behavior of tumor cells.
21670959 ALCAM is expressed at high levels in breast cancer membranes resulting in weakened adherent ability and metastasis.
21440089 cholesterol-induced apoptosis in monocytes is accompanied by reduced expression of ALCAM and attenuated monocyte migration
21430457 High ALCAM expression is associated with the development of endometrioid carcinoma.
21364949 ALCAM may have an important role in thyroid tumor biology.
21293922 polymorphisms in ALCAM gene is associated with breast cancer.
21126364 There is a lineage-specific silencing of ALCAM in bi-potential erythromegakaryocytic progenitor cell lines.
21119604 Both transfection of mimics of microRNA-192 or -215 and ALCAM knockdown by an ALCAM-specific siRNA significantly increased the migration of HFE145 cells
20972617 ALCAM expression was associated with estrogen receptor-positive phenotype, nodal involvement and breast tumor cells in bone marrow. Strong ALCAM expression in ductal carcinomas correlated with shorter recurrence-free intervals/overall survival.
20952758 involvement of ALCAM in the pathogenesis of different types of tumors [review]
20929568 Data suggests that loss of ALCAM expression, due in part to DNA methylation of extensive segments of the promoter, significantly impairs the ability of circulating tumor cells to adhere to each other, and may therefore promote metastasis.
20826154 CD166 is highly expressed within the endogenous intestinal stem cell niche
20726988 Data show that CD6-ALCAM interaction in vitro induced a synergistic co-stimulation of normal peripheral blood mononuclear cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20606680 Prognostic impact of this and other cancer stem cell markers expression in colorectal cancer.
20530423 Loss of ALCAM in breast cancer cells facilitates the invasive behaviour of breast cancer and high levels of ALCAM in the cells have a suppressive role in the aggressive nature of breast cancer cells.
20364042 examined ALCAM expression levels in primary breast cancer and distant metastases of the same patient within 29 autopsy cases to better understand the underlying mechanisms of metastases and the role of adhesion molecules in this process
20220571 Observational study of gene-disease association. (HuGE Navigator)
20208136 ALCAM is expressed in neuroblastoma primary tumors with diverse patterns of subcellular localization.
20180536 Data show that compounds 17 and 18 were discovered as new potential inhibitors, with a nanomolar activity for ADAM-17 isolated enzyme and soluble ALCAM release in cancer cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19626493 Report prognostic significance of the cancer stem cell markers CD133, CD44, and CD166 in colorectal cancer.
19603023 ALCAM overexpression is a relevant independent prognostic marker for poor survival and early tumour relapse in pancreatic cancer.
19337990 upregulation of CD166 in a von Hippel-Lindau tumour suppressor gene defective renal cell carcinoma cell line.
19322904 Elevated levels of ALCAM in serum is associated with breast cancer.
19142865 Increased ALCAM expression in the cytoplasm is associated with oral cancer
18810438 Higher ALCAM expression showed a positive correlation with estrogen receptor status and is a useful predictive marker for the response to taxane-free chemotherapy.
18483249 ALCAM coordinates tissue growth and cell migration in a process involvnig L1CAM
18347173 Decreased/lost ALCAM membrane expression is a marker of poorer outcome in epithelial ovarian cancer.
18279810 Over the past decade, alterations in expression of ALCAM have been reported in several human tumors (melanoma, prostate cancer, breast cancer, colorectal carcinoma, bladder cancer, and esophageal squamous cell carcinoma).
18202807 This study has, for the first time, shown that patients who develop skeletal metastasis tend to have the lowest levels of ALCAM transcripts in their breast cancers.
18172759 activated leukocyte cell adhesion molecule (ALCAM/CD166) may have a role in breast cancer
18171982 disruption of ALCAM-mediated adhesion is a relevant step in ovarian cancer cell motility, and ADAM17/TACE takes part in this process, which may be relevant to invasive potential
18157132 These findings indicate an important function for ALCAM in the recruitment of leukocytes into the brain.
17971418 These results indicate that homotypic and heterotypic ALCAM-mediated adhesion are governed by significantly distinct kinetic and mechanical properties.
17624664 HLA-A *0201 restricted ALCAM peptides primed autologous CD8(+) T cells to elicit cytotoxic response against ALCAM(+) human cancer cells.
16865058 The above results indicate that ALCAM-ALCAM interactions are crucial to the survival and primary site maintenance of breast cancer cells.
16818773 the CD6-ALCAM interaction results in activation of the three MAP kinase cascades, likely influencing the dynamic balance that determines whether resting or activated lymphocytes survive or undergo apoptosis.
16818742 Engagement of CD6 with CD166 on tumor cells plays an important role in gammadelta T cell activation by tumor cells sensitized with nonpeptide antigens endogenously or exogenously.
16650408 Localization of ALCAM specifically at cell-cell junctions in endothelial cells supported its role in transendothelial migration
16204050 Data attribute a novel signaling role to ALCAM in regulation of proteolysis and support its previously postulated sensor function in invasive growth.
16024937 Overexpression of activated leukocyte cell adhesion molecule is associated with tumor invasion and nodal metastasis in esophageal squamous cell carcinoma
15496415 a novel soluble isoform of ALCAM may have ALCAM-dependent and ALCAM-independent functions
15169840 PKCA has a major role in cytoskeleton-dependent avidity modulation of ALCAM.
15140234 the intact cell adhesion function of ALCAM may both favor primary tumor growth and represent a rate-limiting step for tissue invasion from vertical growth phase melanoma.
12843199 ALCAM is expressed on human endometrial epithelial cells and blastocysts.
12481253 ALCAM expression up-regulated in low-grade prostate tumors and down-regulated in high-grade tumors; may play role in progression of prostate cancer

AA Sequence

MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPVFIAF      1 - 70
RSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTIVKVFKQPSKPEIV     71 - 140
SKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVIIFKKEMDPVTQLYTMTSTLEYKTT    141 - 210
KADIQMPFTCSVTYYGPSGQKTIHSEQAVFDIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEE    211 - 280
FLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDAL    281 - 350
PVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM    351 - 420
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQ    421 - 490
LERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKH    491 - 560
VNKDLGNMEENKKLEENNHKTEA                                                   561 - 583
//

Text Mined References (132)

PMID Year Title
26146185 2015 Structures of CD6 and Its Ligand CD166 Give Insight into Their Interaction.
26134500 2015 Prognostic significance of ALCAM (CD166/MEMD) expression in cutaneous melanoma patients.
26004137 2015 CD166 positively regulates MCAM via inhibition to ubiquitin E3 ligases Smurf1 and ?TrCP through PI3K/AKT and c-Raf/MEK/ERK signaling in Bel-7402 hepatocellular carcinoma cells.
25987048 2015 ALCAM is a Novel Cytoplasmic Membrane Protein in TNF-? Stimulated Invasive Cholangiocarcinoma Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25710579 Prognostic Significance of CD44v6, CD133, CD166, and ALDH1 Expression in Small Intestinal Adenocarcinoma.
25562819 2015 Serum CD166: a novel hepatocellular carcinoma tumor marker.
25539763 2015 ALCAM is indirectly modulated by miR-125b in MCF7 cells.
25472586 2015 Clinical implication of CD166 expression in salivary gland tumor.
25420915 2015 JAM-A and ALCAM are therapeutic targets to inhibit diapedesis across the BBB of CD14+CD16+ monocytes in HIV-infected individuals.
25395097 2015 Overexpression of activated leukocute cell adhesion molecule in gastric cancer is associated with advanced stages and poor prognosis and miR-9 deregulation.
25270339 2014 Loss of ALCAM expression is linked to adverse phenotype and poor prognosis in breast cancer: a TMA-based immunohistochemical study on 2,197 breast cancer patients.
25255861 2014 Enhanced down-regulation of ALCAM/CD166 in African-American Breast Cancer.
25094049 2014 Cluster of differentiation 166 (CD166) regulates cluster of differentiation (CD44) via NF-?B in liver cancer cell line Bel-7402.
24966904 2014 DCC is expressed in a CD166-positive subpopulation of chondrocytes in human osteoarthritic cartilage and modulates CRE activity.
24945728 2014 Modulation of CD6 function through interaction with Galectin-1 and -3.
24891117 2014 CD166 plays a pro-carcinogenic role in liver cancer cells via inhibition of FOXO proteins through AKT.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24740813 2014 CD166 regulates human and murine hematopoietic stem cells and the hematopoietic niche.
24710410 2014 miR-483-5p promotes invasion and metastasis of lung adenocarcinoma by targeting RhoGDI1 and ALCAM.
24708484 2014 P21 and CD166 as predictive markers of poor response and outcome after fluorouracil-based chemoradiotherapy for the patients with rectal cancer.
24662291 2014 Syntenin-1 and ezrin proteins link activated leukocyte cell adhesion molecule to the actin cytoskeleton.
24562769 2014 miR126-5p repression of ALCAM and SetD5 in endothelial cells regulates leucocyte adhesion and transmigration.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24501004 2014 Activated leukocyte cell adhesion molecule (CD166): an "inert" cancer stem cell marker for non-small cell lung cancer?
24496453 2014 Dynamic coupling of ALCAM to the actin cortex strengthens cell adhesion to CD6.
24487095 2014 A comprehensive surface proteome analysis of myeloid leukemia cell lines for therapeutic antibody development.
24482231 2014 Cluster of differentiation 166 (CD166) regulated by phosphatidylinositide 3-Kinase (PI3K)/AKT signaling to exert its anti-apoptotic role via yes-associated protein (YAP) in liver cancer.
24385212 2014 ALCAM/CD166 is a TGF-?-responsive marker and functional regulator of prostate cancer metastasis to bone.
24311639 2014 Functional role of endothelial adhesion molecules in the early stages of brain metastasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24044434 2013 Selective arylsulfonamide inhibitors of ADAM-17: hit optimization and activity in ovarian cancer cell models.
23940674 2013 Prognostic value of CD166 expression in cancers of the digestive system: a systematic review and meta-analysis.
23922698 2013 Mechanisms of HIV entry into the CNS: increased sensitivity of HIV infected CD14+CD16+ monocytes to CCL2 and key roles of CCR2, JAM-A, and ALCAM in diapedesis.
23903875 2013 Plasma membrane proteomics of tumor spheres identify CD166 as a novel marker for cancer stem-like cells in head and neck squamous cell carcinoma.
23840677 2013 Clinical significance of altered expression of ?-catenin and E-cadherin in oral dysplasia and cancer: potential link with ALCAM expression.
23539446 2013 Elevated ALCAM shedding in colorectal cancer correlates with poor patient outcome.
23507476 2013 ALCAM--novel multiple sclerosis locus interfering with HLA-DRB1*1501.
23169771 2013 Novel role for ALCAM in lymphatic network formation and function.
23169448 2013 Activated leukocyte cell adhesion molecule soluble form: a potential biomarker of epithelial ovarian cancer is increased in type II tumors.
23148625 2013 Activated leukocyte cell adhesion molecule is a marker for thyroid carcinoma aggressiveness and disease-free survival.
23052204 2013 ALCAM/CD166 adhesive function is regulated by the tetraspanin CD9.
22880034 2012 Identification of CD166 as a surface marker for enriching prostate stem/progenitor and cancer initiating cells.
22745734 2012 ALCAM regulates motility, invasiveness, and adherens junction formation in uveal melanoma cells.
22745698 2012 ALCAM (CD166) expression and serum levels in pancreatic cancer.
22722789 2012 Activated leukocyte cell-adhesion molecule (ALCAM) promotes malignant phenotypes of malignant mesothelioma.
22704111 2012 Pilot genome-wide association search identifies potential loci for risk of erectile dysfunction in type 1 diabetes using the DCCT/EDIC study cohort.
22555284 2012 Detection of activated leukocyte cell adhesion molecule in the serum of breast cancer patients and implications for prognosis.
22482754 2012 Activated leukocyte cell adhesion molecule (CD166)--its prognostic power for colorectal cancer patients.
22304788 2012 Activated leukocyte cell adhesion molecule is expressed in neuroepithelial neoplasms and decreases with tumor malignancy, matrix metalloproteinase 2 expression, and absence of IDH1R132H mutation.
22166264 2012 CD166/activated leukocyte cell adhesion molecule is expressed on glioblastoma progenitor cells and involved in the regulation of tumor cell invasion.
22130902 2012 Effect of EpCAM, CD44, CD133 and CD166 expression on patient survival in tumours of the ampulla of Vater.
21935604 2012 Genetic variation in ALCAM and other chromosomal instability genes in breast cancer survival.
21915031 2011 Tissue microarray analysis of ezrin, KBA.62, CD166, nestin, and p-Akt in melanoma versus banal and atypical nevi, and nonmelanocytic lesions.
21858815 2012 ALCAM (CD166) expression and serum levels are markers for poor survival of esophageal cancer patients.
21816425 2011 ALCAM (CD166) expression as novel prognostic biomarker for pancreatic neuroendocrine tumor patients.
21816001 2011 Activated leukocyte cell adhesion molecule impacts on clinical wound healing and inhibits HaCaT migration.
21757661 2011 Activated leukocyte cell adhesion molecule and prognosis in acute ischemic stroke.
21683980 2011 Low activated leukocyte cell adhesion molecule expression is associated with advanced tumor stage and early prostate-specific antigen relapse in prostate cancer.
21670959 2012 Clinical implications of activated leukocyte cell adhesion molecule expression in breast cancer.
21440089 Cholesterol induces apoptosis-associated loss of the activated leukocyte cell adhesion molecule (ALCAM) in human monocytes.
21430457 2011 Activated leukocyte cell adhesion molecule expression is up-regulated in the development of endometrioid carcinoma.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21364949 2011 Activated leukocyte cell adhesion molecule expression and shedding in thyroid tumors.
21293922 2011 Functional polymorphisms in CD166/ALCAM gene associated with increased risk for breast cancer in a Chinese population.
21269460 2011 Initial characterization of the human central proteome.
21126364 2010 Essential role for ALCAM gene silencing in megakaryocytic differentiation of K562 cells.
21119604 2011 MicroRNA-192 and -215 are upregulated in human gastric cancer in vivo and suppress ALCAM expression in vitro.
20972617 2011 Biologic role of activated leukocyte cell adhesion molecule overexpression in breast cancer cell lines and clinical tumor tissue.
20952758 ALCAM/CD166: cancer-related issues.
20929568 2010 Mechanisms of transcriptional regulation and prognostic significance of activated leukocyte cell adhesion molecule in cancer.
20826154 2010 Characterization of the intestinal cancer stem cell marker CD166 in the human and mouse gastrointestinal tract.
20726988 2010 CD6 synergistic co-stimulation promoting proinflammatory response is modulated without interfering with the activated leucocyte cell adhesion molecule interaction.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20606680 2010 Prognostic impact of the expression of putative cancer stem cell markers CD133, CD166, CD44s, EpCAM, and ALDH1 in colorectal cancer.
20530423 2010 ALCAM, activated leukocyte cell adhesion molecule, influences the aggressive nature of breast cancer cells, a potential connection to bone metastasis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20364042 2010 Expression levels of Activated Leukocyte Cell Adhesion Molecule (ALCAM/CD166) in primary breast carcinoma and distant breast cancer metastases.
20220571 2010 Genetic polymorphisms of adhesion molecules and kidney transplant survival.
20208136 2010 Different subcellular localization of ALCAM molecules in neuroblastoma: Association with relapse.
20180536 2010 Potent arylsulfonamide inhibitors of tumor necrosis factor-alpha converting enzyme able to reduce activated leukocyte cell adhesion molecule shedding in cancer cell models.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19626493 2009 Prognostic significance of the cancer stem cell markers CD133, CD44, and CD166 in colorectal cancer.
19603023 2009 Increased expression of ALCAM/CD166 in pancreatic cancer is an independent prognostic marker for poor survival and early tumour relapse.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19337990 2009 Proteomic identification of differentially expressed plasma membrane proteins in renal cell carcinoma by stable isotope labelling of a von Hippel-Lindau transfectant cell line model.
19322904 2009 Activated leukocyte cell adhesion molecule: a novel biomarker for breast cancer.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19142865 2009 Cytoplasmic accumulation of activated leukocyte cell adhesion molecule is a predictor of disease progression and reduced survival in oral cancer patients.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18810438 2008 [Expression of activated leukocyte cell adhesion molecule in breast cancer. Predictability of the response to taxane-free chemotherapy].
18483249 2008 Attenuation of melanoma invasion by a secreted variant of activated leukocyte cell adhesion molecule.
18347173 2008 Subcellular localization of activated leukocyte cell adhesion molecule is a molecular predictor of survival in ovarian carcinoma patients.
18279810 2008 Activated leukocyte cell adhesion molecule: a new paradox in cancer.
18202807 2008 Expression of the cell to cell adhesion molecule, ALCAM, in breast cancer patients and the potential link with skeletal metastasis.
18172759 2008 Predictive impact of activated leukocyte cell adhesion molecule (ALCAM/CD166) in breast cancer.
18171982 2007 The ALCAM shedding by the metalloprotease ADAM17/TACE is involved in motility of ovarian carcinoma cells.
18157132 2008 Activated leukocyte cell adhesion molecule promotes leukocyte trafficking into the central nervous system.
17971418 2007 Distinct kinetic and mechanical properties govern ALCAM-mediated interactions as shown by single-molecule force spectroscopy.
17624664 2007 Induction of cytotoxic T cell response against HCA661 positive cancer cells through activation with novel HLA-A *0201 restricted epitopes.
16914752 2006 CD6 regulates T-cell responses through activation-dependent recruitment of the positive regulator SLP-76.
16865058 2006 ALCAM/CD166 protects breast cancer cells against apoptosis and autophagy.
16818773 2006 Mitogen-activated protein kinase pathway activation by the CD6 lymphocyte surface receptor.
16818742 2006 Involvement of CD166 in the activation of human gamma delta T cells by tumor cells sensitized with nonpeptide antigens.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16650408 2006 Activated leukocyte cell adhesion molecule is a component of the endothelial junction involved in transendothelial monocyte migration.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16352806 2006 Long-term engagement of CD6 and ALCAM is essential for T-cell proliferation induced by dendritic cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16204050 2005 Activated leukocyte cell adhesion molecule (ALCAM/CD166/MEMD), a novel actor in invasive growth, controls matrix metalloproteinase activity.
16024937 2005 MEMD/ALCAM: a potential marker for tumor invasion and nodal metastasis in esophageal squamous cell carcinoma.
15496415 2004 Molecular isolation and characterization of a soluble isoform of activated leukocyte cell adhesion molecule that modulates endothelial cell function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15294938 2004 Relevance of CD6-mediated interactions in T cell activation and proliferation.
15169840 2004 Cytoskeletal restraints regulate homotypic ALCAM-mediated adhesion through PKCalpha independently of Rho-like GTPases.
15140234 2004 Truncation of activated leukocyte cell adhesion molecule: a gateway to melanoma metastasis.
15048703 2004 Frontline: Optimal T cell activation requires the engagement of CD6 and CD166.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12843199 2003 Human blastocysts and endometrial epithelial cells express activated leukocyte cell adhesion molecule (ALCAM/CD166).
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12481253 2003 ALCAM/CD166 is up-regulated in low-grade prostate cancer and progressively lost in high-grade lesions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11306570 2001 Molecular basis for the homophilic activated leukocyte cell adhesion molecule (ALCAM)-ALCAM interaction.
10673383 2000 Coordinate recruitment of E-cadherin and ALCAM to cell-cell contacts by alpha-catenin.
9920831 1999 HCA, an immunoglobulin-like adhesion molecule present on the earliest human hematopoietic precursor cells, is also expressed by stromal cells in blood-forming tissues.
9502422 1998 MEMD, a new cell adhesion molecule in metastasizing human melanoma cell lines, is identical to ALCAM (activated leukocyte cell adhesion molecule).
9436462 1997 CD6 dependent interactions of T cells and keratinocytes: functional evidence for a second CD6 ligand on gamma-interferon activated keratinocytes.
8823162 1996 Recognition of diverse proteins by members of the immunoglobulin superfamily: delineation of the receptor binding site in the human CD6 ligand ALCAM.
8520490 1995 Molecular model of the N-terminal receptor-binding domain of the human CD6 ligand ALCAM.
7760007 1995 Cloning, mapping, and characterization of activated leukocyte-cell adhesion molecule (ALCAM), a CD6 ligand.
7543097 1995 The membrane-proximal scavenger receptor cysteine-rich domain of CD6 contains the activated leukocyte cell adhesion molecule binding site.