Property Summary

NCBI Gene PubMed Count 420
PubMed Score 94572.86
PubTator Score 5011.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Kidney disease 397 8.186 4.0
diabetes mellitus 1663 7.458 3.7
Liver disease 219 7.262 3.6
Hypertension 293 6.751 3.4
Cancer 2346 6.484 3.2
protein-energy malnutrition 8 5.963 3.0
Anemia 252 5.955 3.0
Peritonitis 37 5.943 3.0
protein-losing enteropathy 11 5.766 2.9
Respiratory failure 30 5.651 2.8
Portal hypertension 21 5.528 2.8
Cerebrovascular disease 231 5.514 2.8
Brain disease 84 5.491 2.7
Hepatitis B 103 5.474 2.7
Coronary artery disease 240 5.433 2.7
Heart disease 279 5.274 2.6
Hypersensitivity reaction type II disease 235 5.269 2.6
Bilirubin metabolic disorder 39 5.23 2.6
Atherosclerosis 275 5.219 2.6
Pneumonia 133 5.174 2.6
Diarrhea 155 5.139 2.6
Diabetic Retinopathy 53 5.091 2.5
Cholestasis 93 5.083 2.5
Inflammatory bowel disease 142 4.977 2.5
Hyperglycemia 120 4.949 2.5
Obesity 616 4.928 2.5
Esophageal varix 10 4.91 2.5
Allergic hypersensitivity disease 123 4.885 2.4
Arthritis 248 4.801 2.4
Decubitus ulcer 10 4.775 2.4
Metabolic acidosis 49 4.75 2.4
tuberculosis 1563 4.716 2.4
Neuropathy 210 4.699 2.3
Hyperparathyroidism 43 4.685 2.3
Varicose veins 15 4.679 2.3
Peripheral vascular disease 90 4.671 2.3
Leukopenia 42 4.594 2.3
Metabolic syndrome X 155 4.574 2.3
Hyperthyroxinemia 9 4.56 2.3
Asthma 349 4.544 2.3
Lipid metabolism disorder 102 4.535 2.3
Ovarian hyperstimulation syndrome 15 4.512 2.3
Hepatitis C 90 4.428 2.2
Acquired immunodeficiency syndrome 164 4.208 2.1
Meningitis 46 4.184 2.1
Cholangitis 20 4.172 2.1
Chronic obstructive pulmonary disease 147 4.165 2.1
Autonomic neuropathy 21 4.153 2.1
Rhinitis 46 4.114 2.1
Amyloidosis 68 4.107 2.1
Arthus reaction 8 4.087 2.0
Hypercalcemia 37 4.072 2.0
Pulmonary Embolism 45 4.045 2.0
Multiple Sclerosis 498 4.042 2.0
Neonatal jaundice 15 4.018 2.0
Intestinal obstruction 16 3.996 2.0
Dementia 129 3.972 2.0
Bronchitis 44 3.926 2.0
Portal vein thrombosis 9 3.904 2.0
interstitial lung disease 292 3.897 1.9
Acute cystitis 37 3.884 1.9
Hypothyroidism 89 3.826 1.9
Malaria 140 3.821 1.9
Hyperhomocysteinemia 34 3.813 1.9
Kawasaki disease 24 3.799 1.9
Tetanus 66 3.795 1.9
Hyperphosphatemia 32 3.787 1.9
cystic fibrosis 1670 3.776 1.9
Pneumocystosis 18 3.762 1.9
Short bowel syndrome 16 3.698 1.8
Mastitis 48 3.609 1.8
Osteoporosis 259 3.608 1.8
Vasculitis 64 3.6 1.8
Hyperthyroidism 50 3.586 1.8
Hyperuricemia 35 3.582 1.8
Hypoglycemia 81 3.578 1.8
Alzheimer's disease 644 3.533 1.8
Fatty liver disease 86 3.472 1.7
Schistosomiasis 38 3.445 1.7
sarcoidosis 368 3.44 1.7
Periodontal disease 37 3.372 1.7
Lymphedema 26 3.3 1.6
Dermatitis 141 3.277 1.6
Leprosy 77 3.256 1.6
Exanthem 39 3.234 1.6
Eosinophilia 65 3.219 1.6
Meningoencephalitis 13 3.213 1.6
Substance abuse 55 3.205 1.6
Diphtheria 23 3.155 1.6
Alcohol dependence 107 3.135 1.6
Tropical sprue 5 3.124 1.6
Capillary leak syndrome 2 3.123 1.6
Thrombophilia 37 3.101 1.6
Visceral leishmaniasis 14 3.098 1.5
Hypersplenism 9 3.076 1.5
Thyrotoxicosis 38 3.076 1.5
Polycystic kidney disease 54 3.074 1.5
Otitis media 32 3.066 1.5
Polyneuropathy 30 3.052 1.5
Bronchiectasis 29 3.03 1.5
Pyuria 6 3.03 1.5
Peptic ulcer disease 11 3.023 1.5
Hypertensive retinopathy 9 3.021 1.5
Influenza 142 3.013 1.5

Expression

  Differential Expression (9)

See source...

Synonym

Accession P02768 E7ESS9 O95574 P04277 Q13140 Q645G4 Q68DN5 Q6UXK4 Q86YG0 Q8IUK7 Q9P157 Q9P1I7 Q9UHS3 Q9UJZ0
Symbols HSA
PRO0883
PRO0903
PRO1341

Gene

ALB

PANTHER Protein Class (1)

PDB

4K71   4N0F   4N0U   1AO6   1BJ5   1BKE   1BM0   1E78   1E7A   1E7B   1E7C   1E7E   1E7F   1E7G   1E7H   1E7I   1GNI   1GNJ   1H9Z   1HA2   1HK1   1HK2   1HK3   1HK4   1HK5   1N5U   1O9X   1TF0   1UOR   1YSX   2BX8   2BXA   2BXB   2BXC   2BXD   2BXE   2BXF   2BXG   2BXH   2BXI   2BXK   2BXL   2BXM   2BXN   2BXO   2BXP   2BXQ   2ESG   2I2Z   2I30   2N0X   2VDB   2VUE   2VUF   2XSI   2XVQ   2XVU   2XVV   2XVW   2XW0   2XW1   2YDF   3A73   3B9L   3B9M   3CX9   3JQZ   3JRY   3LU6   3LU7   3LU8   3SQJ   3TDL   3UIV   4BKE   4E99   4EMX   4G03   4G04   4HGK   4HGM   4IW1   4IW2   4K2C   4L8U   4L9K   4L9Q   4LA0   4LB2   4LB9   4S1Y   4Z69   5FUO   5ID7   5IFO   5IJF  

  Ortholog (2)

Gene RIF (302)

PMID Text
27346974 The results showed that both patients are homozygous for the deletion of a cytosine residue in exon 5, in a stretch of four cytosines starting from nucleotide position 524 and ending at position 527 (NM_000477.5(ALB):c.527delC).
27015568 Our study is one of the first to describe how pre-operative BMI and serum albumin and post-operative changes in these variables impact clinical and perioperative outcomes
26764252 Decreased serum albumin levels in cancer patients were significantly associated with increased risk of VTE and mortality. Serum albumin, a marker of a cancer patient's overall prognosis, could be considered for risk assessment of important clinical outcomes such as VTE and mortality.
26554815 Data suggest that ALB exhibits homodimerization via free cysteine-34, without any potentially immunogenic cross-linkers that are usually prerequisites for homodimerization of amyloidogenic proteins.
26549058 While the weakly interacting HSA NPs did not alter the aggregation kinetic parameters of alphaSN, the rate of primary nucleation increased in the presence of PEI-HSA NPs.
26530188 Data indicate that antecedent C-reactive protein (CRP) was associated with future serum albumin.
26484352 In multivariable linear regression analyses, DeltaGA/HbA1c was independently associated with diabetes duration. In conclusion, this study demonstrated that serum GA levels increase relative to HbA1c levels with time.
26474241 this study explored the details of imidazole derivatives binding to human serum albumin.
26448295 Drospirenone had different effects on the local conformation of HSA and LYZ molecules.
26433342 The influence of glycation process on serum albumin binding to 5-dimethylaminonaphthalene-1-sulfonamide (DNSA), 2-(p-toluidino) naphthalene-6-sulfonic acid (TNS), has been studied.
26406944 ischemia-modified albumin can be effective for demonstrating hypoxia in patients with acute leukemia.
26390126 Data show that patients with a c-reactive protein/albumin ratio (CRP/Alb ratio) > 0.50 had worse survival than patients with a CRP/Alb ratio </= 0.50.
26345979 This study evaluated the relationships among copeptin, ischemia-modified albumin (IMA), and extent of myocardial injury in patients with acute carbon monoxide poisoning.
26339617 CRP and Alb are both promising biomarkers in identification of non-small cell lung cancer patients with poor prognosis and form a possible target for intensifying their therapies.
26320482 Low serum albumin level is associated with reduction in the response rate to first-line therapy in Non-Small Cell Lung Cancer.
26297216 Data suggest glycated serum albumin contributes to oxidative stress in vascular endothelium mediated by 1) NFkappaB activation and subsequent up-regulation of NADPH oxidase and 2) eNOS uncoupling to produce superoxide anions instead of nitric oxide.
26238097 The ratio of delta neutrophil index to serum albumin on emergency department admission is a prognostic marker of 28-day mortality in patients with severe sepsis.
26165120 The kinetic and thermodynamic characteristics of the interaction of albumin with some substrates are adduced, and possibility of albumin being attributed to certain groups of Enzyme Nomenclature is considered.
26118184 Ischemia-modified albumin is not a useful marker in the diagnosis of deep venous thrombosis.
26078940 the experimental results and the molecular modeling data from the interactions of AFP and HSA with PTEN will help us to identify targets for designing drugs and vaccines against human hepatocellular carcinoma.
26053837 initial serum albumin and 24-hour daily protein excretion (24-h DPE) before treatment as prognostic factors in patients with multiple myeloma, were investigated.
26032253 Amino acids of importance for the antioxidant activity of human serum albumin as revealed by recombinant mutants and genetic variants.
25977915 The molecular modeling results reveal that CIT can bind with hydrophobic pocket of HSA with hydrophobic and hydrogen bond force.
25958880 To understand binding characterization of non-steroidal anti-inflammatory drugs to albumin, this study resolved the structure of diclofenac and albumin complex by X-ray crystallography.
25953894 The Cys(34) and Met329 of albumin form adducts with 2-Amino-9H-pyrido[2,3-b]indole.
25895349 The purpose of this study is to identify the potential sites of esterase activity of albumin by the example of its interaction with soman using molecular modeling methods
25862649 Elevated levels of ischemia-modified albumin indicated oxidative damage and oxidative stress in hypothyroidism.
25856158 Enhanced gene silencing through human serum albumin-mediated delivery of polyethylenimine-siRNA polyplexes.
25854289 Glycated albumin levels were positively correlated with subclinical atherosclerosis in middle-aged and elderly Chinese.
25843331 Data suggest that serum IMA (ischemia-modified albumin) levels in subjects with overt and subclinical hyperthyroidism are essentially the same at baseline and with antithyroid drug therapy.
25807652 The albumin-thiol redox state was significantly oxidized in correlation with serum MMP-3 elevation in rheumatoid arthritis
25775261 ischemia modified albumin may act as a marker of ischemia and oxidative stress in newborns delivered to pre-eclamptic mothers.
25758354 These data provide evidence for the partial denaturation of albumin and exacerbated oxidative stress among patients in advanced stages of diabetes nephropathy before and even after dialysis
25748384 A substantial impact of the liposomes on the bilirubin binding to human serum albumin.
25744197 Albumin loss during post-dilution hemodiafiltration did not affect nutritional status.
25735846 This study compared glycated human serum albumin by glucose with HSA glycated by fructose.
25713411 albumin decreases precursor and mature forms of integrin-beta1 through reactive oxygen species-reticulum stress pathway in podocytes.
25681619 The heat induced denaturation of human serum albumin, was investigated.
25669924 Data show that serum albumin (SA) level remained an independent predictor of overall survival (OS) and median leukemia-free survival (LFS).
25651727 Glycated albumin levels showed positive correlation with total serum albumin consentration in hypoalbuminemia.
25550594 Lower serum albumin and male gender are associated with the development of postoperative pancreatic fistula after pancreaticoduodenectomy.
25448930 The aim of the study was to investigate the influence of oxidative stress on human serum albumin (HSA) structure and evaluate of possible alterations in the binding of the drug to oxidized human serum albumin.
25444746 A novel 191Ala-->Thr mutation in serum albumin
25409650 The results showed that after the adsorption of albumin on the gold nanoparticle, human serum albumin was denatured and the amount of alpha-helix significantly decreased.
25398541 Ruthenium (II) complexes interact with human serum albumin and induce apoptosis of tumor cells.
25353308 Plasma free fatty acid levels influence Zn(2+) -dependent histidine-rich glycoprotein-heparin interactions via an allosteric switch on serum albumin.
25353287 When interpreted in conjunction with Arginase-1, albumin in situ hypbidization offers a high level of sensitivity and specificity for diagnosis of hepatocellular carcinoma.
25344603 domain I and III of albumin required for optimal pH-dependent binding to the neonatal Fc receptor
25305605 The decreased binding constants and the number of binding sites of DPPH with HSA by the introduction of the eight antioxidants may result from the competition of the eight antioxidants and DPPH binding to HSA.
25300043 Spectroscopic and molecular modeling study on the separate and simultaneous bindings of alprazolam and fluoxetine hydrochloride to human serum albumin (HSA): with the aim of the drug interactions probing
25220335 Designed Tyr-Tyr dipeptide as a ligand for affinity chromatography separation of human serum albumin.
25218816 Data show that serum albumin (SA)-adjusted GA (SAaGA) reflects glycemic control in Cushing's syndrome.
25211495 Here we propose a possible cellular route and mechanism by which albumin is transferred from blood into CSF across a sub-population of specialised choroid plexus epithelial cells
25129278 Attenuations in serum albumin over time relate to increased mortality in chronic heart failure.
25051913 The pretreatment serum albumin level is a simple, inexpensive and easily measurable marker with prognostic significance in MPM patients treated with platinum-based systemic chemotherapy
25034876 Data suggest that serum albumin may predict survival at the start of treatment.
25031079 curcumin interacts with HSA strongly thereby its poor half life is due to high rate of its metabolic detoxification as reported in literature.
25019475 serum and salivary ischemia-modified albumin significantly increased in preeclampsia
24999531 Ischaemia-modified albumin may be a valuable marker in perinatal hypoxia and intrauterine growth restriction detection.
24967376 low albumin concentration decreases [Ca(2+)]c, while higher concentration, induces increase in [Ca(2+)]c. It was shown that increase in [Ca(2+)] c was mediated by inositol 1,4,5-trisphosphate and released from internal stores.
24915561 Ischemia-modified albumin (IMA) levels were found to be significantly higher in patients with transient tachypnea of the newborn than in controls. Higher IMA was also associated with greater treatment requirements.
24881541 Data indicate that flavonoid derivative 3d can bind to human serum albumin (HSA) with noncovalent bond in a relatively stable way.
24875960 Data indicate that preoperative malnutrition, defined as serum albumin level <3.5 g/dL), was an independent risk factor for postsurgical complications for patients with elective spine surgery.
24798807 [review] Albumin concentration of random urine samples has become the screening tool of choice for the population with diabetes mellitus (DM), considering the rising incidence of DM and the constrained health care resources in many countries.
24769178 N-AcMet is an effective stabilizer of albumin during photo-irradiation, while N-Ac-Trp promotes photo-oxidative damage to albumin.
24744315 Data suggest riboflavin status regulates hepatocyte gene expression; in HepG2 cells, depletion of LSD1 (lysine (K)-specific demethylase 1A) causes aberrant gene regulation in riboflavin-deficient cells resulting in increased ALB expression.
24738021 The circulating albumin, once filtered in plaque, undergoes Cysteine(34) oxidative modifications.
24695471 This study suggests that antecedent low levels of ALB and total protein may be a risk factor for the acquisition of Clostridium difficile infection.
24691203 The main finding of this study is that HSA was identified as a potent physiological inhibitor of the ACE.
24652290 Extending serum half-life of albumin by engineering neonatal Fc receptor (FcRn) binding.
24646103 A novel mutation (R222I) in the ALB gene mediates dominantly inherited dysalbuminemic hyperthyroxinemia.
24627724 Aberrant splicing in the albumin gene is associated with congenital analbuminemia
24585388 Albumin plays an important role in maintaining redox status by regulating the levels of ROS and associated with changes in the ratio of SFA/USFA.
24583848 Data indicate that serum albumin binding site 1 is a preformed binding pocket within the core of subdomain IIA, which comprises six helices of the subdomain and a loop-helix feature (residues 148-154) contributed by subdomain IB.
24494774 The R218S substitution in the albumin gene reported here causes familial dysalbuminemic hyperthyroxinemia that, in terms of the magnitude of serum iodothyronine elevation, is intermediate to the two previously reported mutations at codon 218
24485317 prometryn binding resulted in rearrangement and conformational change of HSA with reduction in alpha-helix and increases in beta-sheet, beta-turn and random coil structures.
24477648 Low serum albumin is associated with metastatic renal cell carcinoma.
24458291 results indicate that there is a positive association between albumin and cognitive performance in physiologically healthy participants.
24416244 effect of hydrogen peroxide oxidation on Human Serum Albumin (HSA) structure, thermal stability and aggregation properties
24359035 Data suggest that human serum albumin (HSA) might serve as a carrier in delivering chitooligomers to target tissues than alpha-1-glycoprotein (AGP) which has pharmacological importance.
24319355 Site marker compettive and fluorescence experiments revealed that the binding of isoimperatorin to HSA occurred at or near site I.
24280624 CB2 receptor expression in proximal tubule cells is modulated by internalization of albumin.
24267981 Data (including data from biophysical studies using Langmuir lipid monolayer technique) suggest that human/bovine ALB exhibits minimal electrostatic repulsion and inserts effectively into phospholipid monolayers. [REVIEW]
24146932 The induced circular dichroism in dansylglycine provoked by its binding to human serum albumin (HSA), was investigated.
24122695 The conformational dynamics of human serum albumin (HSA) was investigated by principal component analysis (PCA) applied to three molecular dynamics trajectories of 200 ns each.
24096130 The binding site to HSA was confirmed by competitive studies of the ruthenium compounds with warfarin.
24076337 No clinical benefit of 25% albumin is shown in patients with ischemic stroke; however, further efforts to identify effective strategies to protect the ischemic brain should not be discouraged.
24038622 Results show that sequential unfolding behavior of different domains of Human Serum Albumin remains same in presence of sucrose; however, a higher GnHCl concentration is required for unfolding, suggesting stabilizing effect of sucrose on HSA.
23958299 human serum albumin influences glycation of fibrinogen
23904329 Data indicate that glutathione (GSH)-cadmium telluride (CdTe) QDs with larger particle size exhibited a much higher effect on human serum albumin (HSA) than the small particles.
23891063 Elevated ischemia-modified albumin serum levels together with low levels of PAPP-A are detected in the first trimester in mothers bearing small-for-gestational-age fetuses.
23888317 Data indicate that C-reactive protein (CRP) and the CRP/albumin ratio showed opposite behavior in groups, significantly reducing their values in treated patients.
23886889 the binding of diosmin to human serum albumin significantly contributes to protect the protein against degradation
23840401 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
23732484 Suggest acetaldehyde-human serum albumin adduct as molecular marker for alcohol intake.
23724004 The binding of synthesized coumarin derivatives with human serum albumin (HSA) at physiological pH 7.2, was studied.
23711095 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
23702842 The aim of this work was to evaluate the ability of oxidative and glycative stressors to modify properties of human serum albumin.
23673386 Human Serum Albumin Inhibits Histone H4-induced Platelet Aggregation in a Dose-dependent Fashion.
23592780 The linear form of glucose forms a covalent bond to Lys-195 of HSA, but this is not the case for fructose.
23538348 Glycated albumin provides a significantly better measure to estimate glycemic control in hemodialysis patients with diabetes. The assessment of glycemic control by HbA1c in these patients might lead to underestimation of glycemic control.
23531836 both conformation and stiffness of HSA molecules in solutions at isoelectric point and at neutral pH are the same
23473402 By employing a circular dichroism (CD) spectroscopic approach, it is shown that biliverdin is the specific CD label of an additional drug binding area in subdomain IB of serum albumin.
23360066 The study detects and characterizes nine individual binding sites by two-dimensional (2D) nuclear magnetic resonance spectroscopy of 18-[(13)C]-oleic acid complexed with human serum albumin.
23351092 During intestinal exfoliative rejection (ExR) after intestinal transplantation, patients had low serum albumin levels, reaching a minimum average of 1.9 +/- 0.3 g/dL. Lower serum albumin levels correlated with worse patient and graft outcome.
23285146 preoperative serum albumin concentration </= 3.5 mg/dL as well as POD1 albumin concentration </= 2.7 mg/dL was an independent predictor of postoperative medical complication and mortality.
23215783 Serum albumin cysteinylation is increased in older, end stage renal disease patients.
23182422 Blood-brain barrier dysfunction and astrocytic albumin uptake is a potential epileptogenic factor in long-term epilepsy-associated gangliogliomas.
23176518 The discovery of this new ALB mutation sheds light on the molecular mechanism underlying the analbuminemic trait and may serve in the development of a rapid genetic test for the identification of a-symptomatic heterozygous carriers.
23104623 The residues of serum albumin that strongly interact with heme were determined.
23103397 Monitoring of the human serum albumin carbonylation level through determination of guanidino group content.
23099538 the (1)H-NMR relaxometric study of Mn(II) binding to HSA is reported. Mn(II) binding to HSA is modulated by Zn(II), pH, and myristate through competitive inhibition and allosteric mechanisms.
22982313 The results suggest that CUG-BP1 binds to nucleotides 51-100 of the human albumin 3'UTR. In human cells CUG-BP1 binding may thus play a role in regulation of albumin expression and, additionally, it may have a function in post-transcriptional control in CHO cells.
22968245 Serum albumin was not affected by short-term perioperative high-energy intake.
22905377 analysis of molten globule intermediates of human serum albumin in low concentration of urea
22878801 predicts major adverse cardiac events in congestive heart failure independent of B-type natriuretic peptide
22870899 Significant differences in albumin ratio are found between patients with advanced Parkinson's disease, and both early-stage and unaffected groups. Conversely, early-phase patients do not differ from healthy subjects.
22832880 Novel glycation sites on serum albumin reveal that non-enzymatic glycation in healthy individuals is more complex than previously thought.
22815976 albumin prevents 6-hydroxydopamine-induced loss of tyrosine hydroxylase
22718756 a significant role for HSA regulating Abeta fibril growth in the brain interstitium.
22685563 Data show a correlation with non-microbial drug resistance as serum albumin (HSA) is capable of self-hydrolysis of beta-lactam drugs, which is further potentiated by pollutants due to conformational changes in HSA.
22675238 Study found first time evidence that human adipocytes express albumin. The results also showed that systemic inflammation does not modulate albumin gene expression.
22658569 Increased carotid artery intima-media thickness and high plasma glycated albumin levels were associated with increased atherosclerosis risk in a Japanese poulation.
22642562 Ischemia-modified albumin might be useful for the prediction and diagnosis of perinatal asphyxia.
22630368 Data indicate that in acute chest pain patients, the N-terminal site of human serum albumin (HSA) has a negligible or limited role in cobalt binding in the albumin cobalt-binding (ACB) assay.
22613267 Detection of a novol homozygous GT transition in the first base of intron 11 (c.1428 1G>T) of the human serum albumin gene in two children with analbuminemia.
22549788 serum albumin possesses chaperone-like properties and that this activity is maintained under a number of physiologically relevant conditions.
22513409 Displacement of a fluorescence probe showed that PCS mainly binds to site II, which is the high-affinity site for PCS, on human serum albumin.
22450170 enhanced reactivity of the albumin thiol at neutral pH upon fatty acid binding
22440250 Glycated albumin/HbA1c ratio is increased in patients with varices and with the bleeding risk of the varices.
22437883 ischemia-modified albumin can act as a biomarker that reflects the presence of diabetic ketoacidosis
22351593 Cys34 plays a more important role than the Met residues in the antioxidant activity of human serum albumin.
22306656 The analysed compounds were able to pass BBB, they present good drug-like properties and they showed a high affinity to HSA.
22244477 Increased serum glycated albumin levels is a biomarker for risk factors in contrast induced-acute kidney injury.
22209935 The first report of native human serum albumin (HSA)-prolactin inducible protein complex formation in seminal plasma.
22120732 the importance of post-translational modifications of albumin and fragments thereof in patients with renal disease
21997768 The study shows the structure of human serum albumin-Myristate-DAUDA ternary complex and identifies clearly the presence of two DAUDA molecules at fatty acid binding site 6 and 7 of albumin, thus showing these two sites are weak fatty acids binding sites.
21950461 The effect of a room temperature ionic liquid on the conformational dynamics of a protein, human serum albumin, is studied by fluorescence correlation spectroscopy.
21843484 The thermal denaturation of human serum albumin and the associated solvation was investigated using terahertz (THz) spectroscopy.
21635915 binding of aristolochic acid I (AAI) to human serum albumin
21539799 Human serum albumin, spin-labeled fatty acids, and Cu(II) protoporphyrin IX-a hemin analog-form a fully self-assembled system that allows obtaining distances and mutual orientations between the paramagnetic guest molecules.
21521316 Data show that leptin is better than any other biological parameter for monitoring the efficacy of renutrition, including albumin, transthyretin, leptin, IGFBP-1, IGFBP-3 and IGF-1.
21494773 Analysis of the S-S stretching region suggested the radical species caused modifications in the 17 disulphide bridges of serum albumin.
21488149 Histidine146 of human serum albumin plays a prominent role at the interface of subdomains IA and IIA in allosteric ligand binding
21456469 The overall efficacy of IMA [ischemia modified albumin]in differentiating AMI[Acute Myocardial Infarction] from Non-AMI cases appears to be comparable to that of CK-MB and cTnI
21439346 Data show that participation of several amino acid residues in drug-HSA complexation, with extended H-bonding network.
21326965 the density of gamma globulin and albumin fractions were significantly associated with HIV status, and among HIV positive patients, with stage of HIV disease and ART.
21271345 Lower albumin levels in African Americans indicate poorer nutritional status at colorectal cancer diagnosis.
21228463 the mechanisms for preventing EGCg oxidation by HSA
21193536 Detection of essentially all human serum albumin-Cys34 modifications over a specified range of mass increases, was studied.
21190670 The Abeta oligomers are recognized by albumin through sites that are evenly partitioned across the three albumin domains and that bind the Abeta oligomers with similar dissociation constants.
21190025 Hypoalbuminemia is a predictor of poor surgical outcomes of colon cancer.
20835227 Rad53 acts on Dbf4-dependent kinases directly by phosphorylating Dbf4, whereas the cyclin-dependent kinase pathway is blocked by Rad53-mediated phosphorylation of the downstream CDK substrate, Sld3
20828817 Low albumin is associated with lymphomatous adult T-cell leukemia/lymphoma.
20818804 The results revealed that a circulating and abundant modified glycated human serum albumin protein in diabetic patients induced a sustained reactive oxygen species production in human endothelial cells.
20716240 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20705604 human serum albumin could be one of these possible partners as it removes hemin bound to ECL3 and interacts with ABCG2, with a K(d) of about 3 mum.
20692819 Data indicate that CD spectroscopy of the HSA and BSA released in solution after desorption from the matrices shows that, while both proteins partially regain their helical structure, they show a distinct behaviour in their tertiary structure.
20603593 2 Korean patients with bisalbuminemia showed genetic variations in the ALB gene.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20381621 Showed human serum albumin co-precipitated with components of the commonly used YPD growth medium in aqueous solutions at pH <5. Co-precipitation and re-solubilization of HSA were solely pH-dependent and occurred almost instantly at room temperature.
20346571 functional and structural aspects of the allosteric modulation of heme and drug (e.g., warfarin and ibuprofen) binding to human serum albumin
20306030 transfer of spin-labelled steric acid between serum albumin and sterically stabilised liposomes
20215742 measurement of prealbumin may be important for nutritional status evaluation, preventing protein insufficiency in milder forms of phenylketonuria
20211614 Our data suggest that the efficacy of this detoxication system is based on the high concentration of albumin in plasma (and in the rest of the body), and not on the catalytic efficacy itself, which is low for albumin.
20171595 the identification of the base change that causes bisalbuminemia in a Croatian family
20160662 Despite the decrease in albumin concentration, albumin synthesis was enhanced in severely burned patients during the flow phase.
20025859 The data suggest that analbuminemia is the result of widely scattered random mutations.
20018855 No binding of albumin was observed at physiological pH to neonatal Fc receptor. At acidic pH, a 100-fold difference in binding affinity was observed.
20018394 The association of urinary albumin excretion with renal dysfunction suggests that the diagnosis of macroalbuminuria is more predictive of end-stage renal disease than of cardiovascular disease.
20006594 A recombinant truncated HSA variant, HSA(Bartin), does not interact with FcRn, which gives a molecular explanation for the low serum levels.
19955769 Ischemia-modified albumin may be used as not only an indicator of myocardial ischemia-reperfusion injury, but also as a useful indicator of the cardioprotective effect of N-acetylcysteine in coronary bypass grafting.
19884191 Results suggested that microenvironment around tryptophan residue was tightly packed at acidic and basic pH although entire conformation was loosened.
19883602 Human serum albumin inhibits Abeta fibrillization through a "monomer-competitor" mechanism
19785033 Five-nanosecond molecular dynamics simulations were performed to study the conformational features of its primary ligand binding sites.
19734142 Ibuprofen binding impairs allosterically peroxynitrite isomerization by HSA-heme-Fe(III).
19733855 This study suggests that glycated serum albumin induces expression of IL-8 in VSMCs and that TLR-4, mitogen-activated protein kinases, NF-kappaB, and NADPH oxidase are involved in that process.
19711930 As water loading increases, there is evidence for progressive refolding of loop 1 of domain I followed by recoupling with domains I, II, and III in the [C4mim][BF4]/ddH2O mixtures at 20 degrees C.
19707690 a crucial role of a basic amino acid triad the entrance of the heme pocket in rHSA (Arg-114, His-146, Lys-190) for O(2) and CO binding to the prosthetic Fe(2+)PP group
19664386 Advanced glycation end productsof human serum albumin stimulate tubular epithelial cells to produce PAI-1 through activation of NADPH oxidase.
19615354 an association of increased GA, hsCRP and sICAM-1 levels with diffuse coronary artery disease in patients with type 2 diabetes mellitus
19601929 Structural information on human serum albumin-lysophospholipid interaction provide understanding of transport and distribution of lysophospholipids.
19588173 interaction between 5-Methyluridine and human serum albumin under simulative physiological conditions
19572666 systematic study on the relationship between HSA amyloid-like fibrillation kinetics, fibrillation pathways and the resulting aggregated proteins under different conditions
19520864 N99D and N99H mutations enhance Zn(2+) binding but alter protein stability, whereas mutation of His(67) to alanine removes an interdomain H-bond and weakens Zn(2+) binding.
19505594 Analysis of modified albumins showed that both glycation and oxidation increase the albumin iron binding capacity.
19484197 Human umbilical vein endothelial cells exposed to human serum albumin-advanced glycation end-product 4 were apoptotic and not necrotic.
19450464 To gain insight into the carrier function of HSA, the binding of levamlodipine with HSA has been investigated as a model system by a combined experimental and theoretical/computational approach.
19404566 Iron metabolism influences HbA(1C) levels, but not glycated albumin levels in premenopausal women.
19377253 In type 2 diabetic patients, microalbuminuria is accompanied by elevated HS-CRP (high sensitivity C-reactive protein)
19375269 Ischemia modified albumin (IMA) and C-reactive protein increase in myocardial damage; IMA also increases in benign prostate hyperplasia
19339807 fatty acid-binding protein-5, squamous cell carcinoma antigens 2, alpha-enolase, annexin II, apolipoprotein A-I and albumin were detected at a high level in Atopic dermatitis skin lesions, but scarcely in the normal controls
19318029 Hypercholesterolemia is associated with an increase in inflammatory and oxidative stress biomarkers, and it also reduces the capacity of albumin to bind cobalt owing to ischemia, resulting in an increased IMA.
19298387 Here, biochemical characterization by (1)H-NMR relaxometry and optical spectroscopy of a truncated form of HSA (tHSA) encompassing domains I and II (Asp1-Glu382) is reported.
19212124 In this review, evidence is shown that screening for albuminuria may be of great benefit, not only as an argument to start treatment to prevent progressive renal function loss, but also to prevent cardiovascular events.
19139584 analysis the binding properties of terminally substituted alkanes (C(n)X, X = COOH, OH, CHO, NH(2)) to human serum albumin
19011736 Serum albumin at admission would be a useful predictor of the functional outcome and trials for the correction of hypoalbuminaemia from the acute stage would be helpful to decrease the risk of poor outcome in ischaemic stroke patients.
18979581 During parenteral nutrition infusion, albumin synthesis increased significantly in pediatric Crohn disease.
18958405 Investigate the movement of intravitreal human serum albumin nanoparticles in the vitreous and retina.
18791744 proband presented with acute glomerulonephritis and was found to have underlying congenital analbuminemia
18579803 Copper is taken up efficiently from albumin and alpha2-macroglobulin by cultured human cells by more than one mechanism.
18513410 Ischemia-modified albumin is a good alternative to D-dimer in pulmonary embolism diagnosis in terms of both cost and efficiency.
18474236 This review brings together recent insights on albumin antioxidant properties.
18464274 Fourier transform infrared spectroscopy and circular dichroism binding studies indicate that the conformation of human serum albumin is not at all affected when bound to porphyrin.
18386863 attempt has been made to characterize the simultaneous binding of the two ligands in various temperature-dependent folded states of human serum albumin
18346470 These results suggest that oxidative stress and fatty acids on albumin can influence albumin-cobalt binding in patients with fatty liver by independent mechanisms.
18323672 Serum albumin was significantly associated with the severity of retinopathy and neuropathy.
18287254 Study demonstrates decreased mortality and hospitalization risk with albumin > or = 3.5/3.2 g/dl and suggests that adolescent hemodialysis patients who are able to achieve serum albumin > or = 4.0/3.7 g/dl may have the lowest mortality risk.
18256067 Obstructive sleep apnoea patients demonstrated a reduction in serum albumin antioxidant properties
18200583 The aim of this study was to evaluate the levels of ischemia-modified albumin and lactate in patients with established anemia associated with chronic kidney disease and its correlations with hemoglobin levels.
18200582 Results of ischemia-modified albumin and CRP were correlated with final diagnoses of nonischemic chest pain (NICP) and acute coronary syndrome (ACS).
18192916 Plasma albumin mRNA quantification predicts posttransplant hepatocellular carcinoma recurrence.
18178096 different temperature-induced folded states of human serum albumin in buffer solutions of widely differing pH values
18068661 Hence, the analysis of spectral data confirms the ITC results about the biphasic mechanism of HSA folding changes induced by CPC.
18054940 Circulating ischemia modified albumin is negatively correlated to melatonin in ST-elevation myocardial infarct-patients
18029235 Changes of net charge and alpha-helical content affect the pharmacokinetic properties of human serum albumin.
18028874 Direct titrations of HSA with Abeta40 was monitored using circular dichroism spectroscopy and a dissociation constant (K(d)) of 5+/-1 microM for a HSA complex with Abeta40 was obtained.
17987802 the oxidation of plasma proteins, especially human serum albumin , might enhance oxidative stress in hepatocellular carcinoma patients.
17940721 Systemic lupus erythrmatosus patients with lower serum albumin had lower normalized high-frequency power and higher low-/high-frequency power ratio
17603933 Enhances antioxidant activity of quercetin by regenerating some of its oxidation products retaining a H-donating activity.
17587712 An increased serum level of glycated albumin is associated with the presence and severity of coronary artery disease, and may be useful in screening patients with type 2 diabetes mellitus.
17575979 1.4A crystal structure of bacterial albumin-binding (GA) domain, and compare it with the crystal structure of the GA-albumin complex.
17499233 Increased serum levels of glycated albumin, C-reactive protein and tumor necrosis factor-alpha are associated with the presence and severity of coronary artery disease and renal impairment in patients with type 2 diabetes mellitus
17467280 The concentration of this protein transfected into tobacco roots was 0.087 ng ml whereas the soil concntration was 0.049 ng g.
17460892 Results set a good basis for the establishment of transgenic porcine which expresses human serum albumin.
17438360 the active site in serum albumin inhibiting endothelial apoptosis is partially cryptic, and acts via a G-coupled protein PI3K-dependent mechanism
17347578 Serum levels of albumin and CRP correlated with dialysis patients' treatment costs. Achieving the Kidney Disease Outcomes Quality Initiative targets may be associated with lower costs.
17301560 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
17200780 antibodies to beta2GP1, and to a lesser extent with serum albumin, leads to modifications in the cellular and protein composition of atherosclerotic plaques
17184834 The aim of present study was to examine the interaction of retinol and retinoic acid with human serum albumin in aqueous solution at physiological conditions using constant protein concentration and various retinoid contents.
17109502 The biliary IL-6 and TNF-alpha levels were positively correlated with serum DBIL, TBA and gamma-GT levels in infantile hepatitis syndrome subjects.
17067818 Structural evidence of esterase activity of human serum albumin.
17064838 The electrostatic interaction of amino acid lysines 190, 195 and 199 of human serum albumin (HSA) with bilirubin have been investigated
17058928 Data show that the binding constants of serum albumin and ZnPc(COOH)16 were 2.25-2.94 x 10(6) L x mol(-1).
17054386 The protein secondary structure, analysed by CD spectroscopy, showed no major alterations at low resveratrol concentrations,whereas at high pigment content there is a major increase of the alpha-helix.
17048876 formation of amyloid fibrils in the plasma protein human serum albumin under different in vitro conditions
17048273 Our results show clear evidence that the conserved H166 is a key player in the FcRn-albumin interaction.
17002873 thermal conformational changes of human serum albumin in phosphate buffer, 10 mM at pH = 7 are investigated; results indicate that temperature increment from 25 degrees C to 55 degrees C induces reversible conformational changes in the structure of HSA
16979183 Results show that fatty acids bind differentially, based on chain length, to different domains of human serum albumin, and that binding is sensitive to amino acid substitutions in other parts of the protein.
16939204 Analysis of adduction kinetics together with HSA structure and target residue pK(a) values suggest that location in the hydrophobic binding cavity and low predicted pK(a) of H242 account for its high reactivity toward HNE.
16916777 The urinary excretion of alpha1-microglobulin and albumin was significantly elevated in nine patients, and the urinary excretion of the two proteins correlated significantly.
16843720 some mutant forms of HSA might potentially bind fatty acids and may be protective against the development of coronary heart disease
16721655 The typical Boltzmann's equation was used with a new approach to calculate the dissociation constants as well as the standard free energy changes for the HSA-bilirubin interactions.
16705651 analysis of epigallocatechin-3-gallate interactino with human serum albumin by fluorescence, fourier transform infrared, circular dichroism, and docking studies
16703327 Synthesis of albumin and fibrinogen is upregulated in type 2 diabetic patients with increased urinary albumin excretion.
16608438 ATRA triggers an increase in the translation of C/EBPbeta-LIP that antagonizes C/EBP transactivators by interacting with their binding sites in the albumin promoter
16454580 rate of folic acid photodegradation decreased drastically in the presence of ALB, whereas the spectral characteristics of the photoproducts remained constant
16413837 Five interacting sites appear to account for the changes in structure of human serum albumin that accompany its binding of myristate.
16337614 Post-operative ischemia-modified albumin increases are consistent with ischemic modification of albumin during exposure to ischemic conditions in skeletal muscle.
16329499 Data shoe that H-bond and Van der Waals are two main reactions between HP and HSA.
16324740 The unfolding of domain II precedes that of domain I and the unfolding of domain III follows that of domain I.
16253963 Human granulosa cells express the carboxyl and amino terminal part of the HSA gene in levels comparable to those found in human hepatocytes.
16213467 Human plasma contains four esterases: butyrylcholinesterase, paraoxonase, acetylcholinesterase, and albumin.
16201370 Data show that after the vitamin B6 was added into HSA solution the fluorescence of HSA was quenched partially.
16159939 All three major serum-binding proteins, thyroxine-binding globulin, transthyretin, and albumin, were present in cytosol. May modify thyroid hormone deiodination and materno-fetal thyroid hormone transport.
16156788 report myristate binding to the N and B conformational states of Mn(III)heme-HSA (i.e. at pH 7.0 and 10.0, respectively) as investigated by optical absorbance and NMR spectroscopy
16054887 In the present study, the qualitative modification of albumin in HD patients (n = 20) was examined and their results were compared with healthy age-matched controls (n = 10).
16037246 Modification of arginine residues by methylglyoxal may be particularly damaging because arginine residues have a high frequency of occurrence in ligand and substrate recognition sites in receptor and enzyme active sites.
15996651 Analbuminemia in a Swiss family is caused by a C --> T transition at nucleotide 4446
15942949 Cardamonin binding to albumin bindig site II alters protein secondary structure.
15913893 Contribution of histidine residues located in domain I into the neutral-to-basic (N-B) transition of human serum albumin was studied using site-directed mutagenesis.
15890566 A pictorial model for the unfolding of the domains has been formulated
15837789 glycation can influence or change local secondary structure in human serum albumin, as shown through NMR analysis of synthetic peptides
15832324 The protein secondary structure showed no alterations at low PEG concentration (0.1 mM), whereas at high polymer content (1 mM), a reduction of alpha-helix from 59 ) to 53% and an increase of beta-turn from 11 to 22% occurred in the PEG-HSA complexes.
15740590 Albumin colocalized together with its transcription factor PCD/DCoH/HNF-1alpha in suprabasal keratinocytes in human full-thickness skin sections and in keratinocytes cultured in serum-free medium.
15716124 Based on the fluorescence responses for both hypocrellin B(JB) and human serum albumin HSA), binding of HB to HSA are more specific rather than distributed randomly on the surface of HSA.
15646839 albumin may have a role in progression of bronchial carcinoma
15353599 the role of this fluidity in the correlation between stability and function of the protein
15210122 The effective specific volume, the activation energy and entropy of viscous flow for hydrated HSA were calculated
15149953 ALB increased at 10 min postexercise in younger men only, whereas fibrinogen was elevated in both groups through 180 min postexercise.
15137089 human serum albumin studied by acoustic relaxation spectroscopy
14983239 serum albumin may have a role in preventing the progression of atherosclerosis to major adverse cardiac events in patients with a low risk profile
14759223 Propofol-binding sites are primarily found in domain III, whereas halothane sites are more widely distributed. Greater hydrophobic contacts, van der Waals interactions & hydrogen-bond formation account for the stronger binding of propofol.
14687905 The developed immunoassay system using fluorescence dye and lateral-flow chromatography is a simple, fast and reliable method for quantifying the albumin concentration in whole blood.
14520007 Albumin isolated from uraemic plasma had a characteristically increased melting temperature because of bound ligands; purification of uraemic plasma at pH 5.08 completely restored the binding affinity of albumin for all the marker ligands
13677478 A detailed chemometric analysis of ligand binding to domain-3A of human serum albumin is described. NMR & fluorescence data on a set of 889 chemically diverse compounds were used to develop a group contribution model based on 74 chemical fragments.
12970360 albumin affects glucose metabolism by impairing insulin-induced insulin receptor substrate (IRS) signaling through a protein kinase C alpha-mediated mechanism
12969171 Synthesis rate of albumin and fibrinogen are coordinately up-regulated.
12815038 albumin is a substrate of human chymase
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12617161 review of role of serum albumin as a transport protein
12480711 Albumin is the major component of plasma that blocks CLL cell killing by chlorambucil or radiation.
12118010 chemical analysis of electrostatic interactions in human serum albumin
12009306 Data show that glucose interacts with multiple sites on human serum albumin, affecting its biochemical and biophysical properties. This may interfere with HSA normal function contributing to diabetic complications.
12007569 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
11931649 Efficient identification of photolabelled amino acid residues by combining immunoaffinity purification with MS: revealing the semotiadil-binding site and its relevance to binding sites for myristates in domain III of human serum albumin.
11906609 structural characterization of structure in solution and dry state
11847277 Results support the involvement of certain basic amino acid residues in the catabolism of HSA-bound 15-keto-PGE2.
11810025 Tryptophan at amino acid position 214 is the principal site for nitrosation.
11743713 first high-resolution crystal structures of HSA complexed with two important unsaturated fatty acids, the monounsaturated oleic acid (C18:1) and the polyunsaturated arachidonic acid (C20:4)
11734007 solvent effects on the secondary structure of two proteins (serum albumin and apomyoglobin) were examined by circular dichroism following encapsulation in the hydrated pores of a silica glass matrix by the sol-gel method
11689002 binding study with novel antiretroviral nucleoside derivatives of AZT
11145723 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
11140838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
10780709 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
10580404 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
10086322 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
9168236 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
8605586 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
8312056 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
7576927 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation
1810199 Activated granulocytes and macrophages producing hypochlorite/hypochlorous acid-altered isolated proteins antithrombin III and human serum albumin bind to gp120 and inhibit viral proliferation

AA Sequence

MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEV      1 - 70
TEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLV     71 - 140
RPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELR    141 - 210
DEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADD    211 - 280
RADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVF    281 - 350
LGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFE    351 - 420
QLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK    421 - 490
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHK    491 - 560
PKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL                         561 - 609
//

Text Mined References (434)

PMID Year Title
27346974 2016 A nucleotide deletion and frame-shift cause analbuminemia in a Turkish family.
27226040 2016 Hyperglycemia induced structural and functional changes in human serum albumin of diabetic patients: a physico-chemical study.
27164421 2016 Serum albumin attenuates the open-channel blocking effects of propofol on the human Kv1.5 channel.
27048041 2016 Correlation of serum albumin with the clinical features and prognosis of preterm neonates in the neonatal intensive care unit.
27015568 2016 Influence of Body Mass Index and Albumin on Perioperative Morbidity and Clinical Outcomes in Resected Pancreatic Adenocarcinoma.
26965637 2016 Proteolytic processing of human serum albumin generates EPI-X4, an endogenous antagonist of CXCR4.
26951925 2016 Human plasma lipocalins and serum albumin: Plasma alternative carriers?
26909491 2016 Thymosin ?1 Interacts with Exposed Phosphatidylserine in Membrane Models and in Cells and Uses Serum Albumin as a Carrier.
26901698 2016 Albumin and apolipoprotein H mRNAs in human plasma as potential clinical biomarkers of liver injury: analyses of plasma liver-specific mRNAs in patients with liver injury.
26764252 2016 Association Between Decreased Serum Albumin With Risk of Venous Thromboembolism and Mortality in Cancer Patients.
26554815 2015 New insights into in vitro amyloidogenic properties of human serum albumin suggest considerations for therapeutic precautions.
26549058 2015 Strong interactions with polyethylenimine-coated human serum albumin nanoparticles (PEI-HSA NPs) alter ?-synuclein conformation and aggregation kinetics.
26530188 2015 Factors affecting serum albumin in the perioperative period of colorectal surgery: a retrospective study.
26484352 2015 Glycated Albumin Levels in Patients with Type 2 Diabetes Increase Relative to HbA1c with Time.
26474241 2016 Synthesis of imidazole derivatives and the spectral characterization of the binding properties towards human serum albumin.
26448295 2016 Binding properties of drospirenone with human serum albumin and lysozyme in vitro.
26433342 2016 Alteration of human serum albumin tertiary structure induced by glycation. Spectroscopic study.
26406944 2015 The indicator of hypoxia in acute leukemia: Ischemia-modified albumin.
26390126 2015 A Novel Inflammation-Based Prognostic Score, the C-Reactive Protein/Albumin Ratio Predicts the Prognosis of Patients with Operable Esophageal Squamous Cell Carcinoma.
26385339 2016 Serum Albumin Domain Structures in Human Blood Serum by Mass Spectrometry and Computational Biology.
26345979 2015 Correlations among copeptin, ischemia-modified albumin, and the extent of myocardial injury in patients with acute carbon monoxide poisoning.
26339617 2015 Prognostic Significance of Serum Inflammatory Response Markers in Newly Diagnosed Non-Small Cell Lung Cancer before Chemoirradiation.
26320482 2015 Pretreatment Serum Albumin Level is an Independent Prognostic Factor in Patients with Stage IIIB Non-Small Cell Lung Cancer: A Study of the Turkish Descriptive Oncological Researches Group.
26297216 Glycated human serum albumin induces NF-?B activation and endothelial nitric oxide synthase uncoupling in human umbilical vein endothelial cells.
26238097 2015 Newly designed delta neutrophil index-to-serum albumin ratio prognosis of early mortality in severe sepsis.
26165120 [On the Enzymatic Activity of Albumin].
26118184 2015 Ischemia-Modified Albumin is not Elevated in Deep Venous Thrombosis.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26078940 2015 Molecular Analysis of AFP and HSA Interactions with PTEN Protein.
26053837 2015 Prognostic Significance of Initial Serum Albumin and 24 Hour Daily Protein Excretion before Treatment in Multiple Myeloma.
26032253 2015 Amino acids of importance for the antioxidant activity of human serum albumin as revealed by recombinant mutants and genetic variants.
25977915 2015 Binding of citreoviridin to human serum albumin: multispectroscopic and molecular docking.
25958880 2015 Structural basis of non-steroidal anti-inflammatory drug diclofenac binding to human serum albumin.
25953894 2015 2-Amino-9H-pyrido[2,3-b]indole (A?C) Adducts and Thiol Oxidation of Serum Albumin as Potential Biomarkers of Tobacco Smoke.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25921529 2015 Discovery and characterization of an endogenous CXCR4 antagonist.
25895349 [Serum albumin: search for new sites with esterase activity according to molecular modeling data].
25862649 2015 Ischemia-modified albumin levels in overt and subclinical hypothyroidism.
25856158 2015 Enhanced gene silencing through human serum albumin-mediated delivery of polyethylenimine-siRNA polyplexes.
25854289 2015 Associations of glycated haemoglobin A1c and glycated albumin with subclinical atherosclerosis in middle-aged and elderly Chinese population with impaired glucose regulation.
25843331 2015 Ischemia-modified albümin and malondialdehyde levels in patients with overt and subclinical hyperthyroidism: effects of treatment on oxidative stress.
25807652 2015 Elevated oxidative stress monitored via the albumin-thiol redox state is correlated with matrix metalloproteinase-3 elevation in patients with rheumatoid arthritis.
25775261 2015 Evaluation of cord blood ischemia modified albumin in normal pregnancies and pre-eclampsia.
25758354 2015 Antioxidant capacity and structural changes of human serum albumin from patients in advanced stages of diabetic nephropathy and the effect of the dialysis.
25748384 2015 Bilirubin, model membranes and serum albumin interaction: The influence of fatty acids.
25744197 2015 Factors associated with albumin loss in post-dilution hemodiafiltration and nutritional consequences.
25735846 2016 Effects of non-enzymatic glycation in human serum albumin. Spectroscopic analysis.
25732556 2015 Structure and enzymatic activities of human serum albumin.
25713411 2015 Albumin overload down-regulates integrin-?1 through reactive oxygen species-endoplasmic reticulum stress pathway in podocytes.
25681619 2015 Thermal induced unfolding of human serum albumin isomers: assigning residual ? helices to domain II.
25669924 2015 Hypoalbuminemia is a surrogate biomarker of poor prognosis in myelodysplastic syndrome even when adjusting for comorbidities.
25651727 2014 Serum glycated albumin level in hypoalbuminemia.
25550594 2015 Perioperative serum albumin correlates with postoperative pancreatic fistula after pancreaticoduodenectomy.
25448930 2015 Spectroscopic analysis of the impact of oxidative stress on the structure of human serum albumin (HSA) in terms of its binding properties.
25444746 2015 Novel silent albumin variant (191Ala?Thr) detected by TOF MS of whole plasma.
25409650 2015 An in-depth view of human serum albumin corona on gold nanoparticles.
25398541 2015 Ruthenium (II) complexes interact with human serum albumin and induce apoptosis of tumor cells.
25353308 2015 Plasma free fatty acid levels influence Zn(2+) -dependent histidine-rich glycoprotein-heparin interactions via an allosteric switch on serum albumin.
25353287 2015 Branched chain in situ hybridization for albumin as a marker of hepatocellular differentiation: evaluation of manual and automated in situ hybridization platforms.
25344603 2014 Interaction with both domain I and III of albumin is required for optimal pH-dependent binding to the neonatal Fc receptor (FcRn).
25305605 2015 Probing the interaction of human serum albumin with DPPH in the absence and presence of the eight antioxidants.
25300043 2015 Spectroscopic and molecular modeling study on the separate and simultaneous bindings of alprazolam and fluoxetine hydrochloride to human serum albumin (HSA): with the aim of the drug interactions probing.
25220335 2014 Combined docking, molecular dynamics simulations and spectroscopic studies for the rational design of a dipeptide ligand for affinity chromatography separation of human serum albumin.
25218816 2014 Serum albumin-adjusted glycated albumin is an adequate indicator of glycemic control in patients with Cushing's syndrome.
25211495 2014 Cellular specificity of the blood-CSF barrier for albumin transfer across the choroid plexus epithelium.
25129278 2014 Serum albumin changes and multivariate dynamic risk modelling in chronic heart failure.
25051913 2014 Serum albumin as a significant prognostic factor in patients with malignant pleural mesothelioma.
25034876 2015 Serum albumin as a stable predictor of prognosis during initial treatment in patients with diffuse large B cell lymphoma.
25031079 2014 Study of interaction of human serum albumin with curcumin by NMR and docking.
25019475 2014 IMA and IMAR in serum and saliva of preeclampsia--a preliminary study.
24999531 2015 The association between ischaemia-modified albumin levels in umbilical vein and intrauterine growth restriction.
24967376 2014 Plasma albumin induces cytosolic calcium oscilations and DNA synthesis in human cultured astrocytes.
24915561 2015 Levels of ischemia-modified albumin in transient tachypnea of the newborn.
24881541 2014 Molecular interaction study of flavonoid derivative 3d with human serum albumin using multispectroscopic and molecular modeling approach.
24875960 2014 Preoperative serum albumin level as a predictor of postoperative complication after spine fusion.
24798807 2014 Diagnostic performance of random urine samples using albumin concentration vs ratio of albumin to creatinine for microalbuminuria screening in patients with diabetes mellitus: a systematic review and meta-analysis.
24769178 2014 N-acetyl-l-methionine is a superior protectant of human serum albumin against photo-oxidation and reactive oxygen species compared to N-acetyl-L-tryptophan.
24744315 2014 Transcriptional regulation of the albumin gene depends on the removal of histone methylation marks by the FAD-dependent monoamine oxidase lysine-specific demethylase 1 in HepG2 human hepatocarcinoma cells.
24738021 2014 Human serum albumin Cys34 oxidative modifications following infiltration in the carotid atherosclerotic plaque.
24695471 2014 Temporal changes in serum albumin and total protein in patients with hospital-acquired Clostridium difficile infection.
24691203 2014 New perspectives in the renin-angiotensin-aldosterone system (RAAS) II: albumin suppresses angiotensin converting enzyme (ACE) activity in human.
24652290 2014 Extending serum half-life of albumin by engineering neonatal Fc receptor (FcRn) binding.
24646103 2014 A novel albumin gene mutation (R222I) in familial dysalbuminemic hyperthyroxinemia.
24627724 2014 Congenital analbuminemia caused by a novel aberrant splicing in the albumin gene.
24585388 2014 The role of albumin and PPAR-? in differentiation-dependent change of fatty acid profile during differentiation of mesenchymal stem cells to hepatocyte-like cells.
24583848 2014 Interactive association of drugs binding to human serum albumin.
24494774 2014 A novel mutation in the Albumin gene (R218S) causing familial dysalbuminemic hyperthyroxinemia in a family of Bangladeshi extraction.
24485317 2014 Interaction of prometryn to human serum albumin: insights from spectroscopic and molecular docking studies.
24477648 2014 Prognostic significance of serum albumin in patients with metastatic renal cell carcinoma.
24458291 2014 Neuropsychological performance is positively associated with plasma albumin in healthy adults.
24416244 2014 Oxidation enhances human serum albumin thermal stability and changes the routes of amyloid fibril formation.
24359035 2015 Differential interactions and structural stability of chitosan oligomers with human serum albumin and ?-1-glycoprotein.
24319355 2013 Studies of the interaction between isoimperatorin and human serum albumin by multispectroscopic method: identification of possible binding site of the compound using esterase activity of the protein.
24280624 2013 Cannabinoid receptor 2 expression in human proximal tubule cells is regulated by albumin independent of ERK1/2 signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24267981 2014 Serum albumin in 2D: a Langmuir monolayer approach.
24146932 2013 Investigation of human albumin-induced circular dichroism in dansylglycine.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24122695 2014 A principal component analysis of the dynamics of subdomains and binding sites in human serum albumin.
24096130 2013 Exploring the effect of the ligand design on the interactions between [Ru(?(5)-C5H5)(PPh3)(N,O)][CF3SO3] complexes and human serum albumin.
24076337 2013 High-dose albumin treatment for acute ischaemic stroke (ALIAS) Part 2: a randomised, double-blind, phase 3, placebo-controlled trial.
24038622 2013 Mechanistic investigation of domain specific unfolding of human serum albumin and the effect of sucrose.
23958299 2013 A study on human serum albumin influence on glycation of fibrinogen.
23904329 2013 Effect of CdTe quantum dots size on the conformational changes of human serum albumin: results of spectroscopy and isothermal titration calorimetry.
23891063 2013 Ischemia-modified albumin in pregnancy.
23888317 2013 Fish oil decreases C-reactive protein/albumin ratio improving nutritional prognosis and plasma fatty acid profile in colorectal cancer patients.
23886889 2013 Diosmin binding to human serum albumin and its preventive action against degradation due to oxidative injuries.
23732484 2013 Immune response to acetaldehyde-human serum albumin adduct among healthy subjects related to alcohol intake.
23724004 2013 Elucidation of the binding mechanism of coumarin derivatives with human serum albumin.
23702842 2013 Structural alterations of human serum albumin caused by glycative and oxidative stressors revealed by circular dichroism analysis.
23673386 2013 Histone induced platelet aggregation is inhibited by normal albumin.
23602811 2013 Novel insights into the pleiotropic effects of human serum albumin in health and disease.
23592780 2013 Structural mechanism of ring-opening reaction of glucose by human serum albumin.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23538348 2013 Glycated albumin versus glycated hemoglobin as glycemic indicator in hemodialysis patients with diabetes mellitus: variables that influence.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23531836 2013 A viscometric approach of pH effect on hydrodynamic properties of human serum albumin in the normal form.
23473402 2013 Subdomain IB is the third major drug binding region of human serum albumin: toward the three-sites model.
23384347 2013 The transferrin receptor-1 membrane stub undergoes intramembrane proteolysis by signal peptide peptidase-like 2b.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23360066 2013 Correspondence of fatty acid and drug binding sites on human serum albumin: a two-dimensional nuclear magnetic resonance study.
23351092 Serum albumin level during intestinal exfoliative rejection: a potential predictor of graft recovery and patient outcome.
23285146 2012 The roles of albumin levels in head and neck cancer patients with liver cirrhosis undergoing tumor ablation and microsurgical free tissue transfer.
23215783 2013 Human serum albumin cysteinylation is increased in end stage renal disease patients and reduced by hemodialysis: mass spectrometry studies.
23182422 2013 Albumin storage in neoplastic astroglial elements of gangliogliomas.
23176518 2013 A novel mutation in the albumin gene (c.1A>C) resulting in analbuminemia.
23104623 2012 Dynamics of heme complexed with human serum albumin: a theoretical approach.
23103397 2013 Monitoring of the human serum albumin carbonylation level through determination of guanidino group content.
23099538 2012 Mn(II) binding to human serum albumin: a ¹H-NMR relaxometric study.
22982313 2012 CUG binding protein 1 binds to a specific region within the human albumin 3' untranslated region.
22968245 2012 Increased energy intake in hip fracture patients affects nutritional biochemical markers.
22905377 2002 Molten globule intermediates of human serum albumin in low concentration of urea.
22878801 2012 Correlation between serum concentrations of B-type natriuretic peptide and albumin in patients with chronic congestive heart failure.
22870899 2012 Increased blood-cerebrospinal fluid transfer of albumin in advanced Parkinson's disease.
22832880 2012 Investigation of non-enzymatic glycosylation of human serum albumin using ion trap-time of flight mass spectrometry.
22815976 2012 Human albumin prevents 6-hydroxydopamine-induced loss of tyrosine hydroxylase in in vitro and in vivo.
22718756 2012 Human serum albumin can regulate amyloid-? peptide fiber growth in the brain interstitium: implications for Alzheimer disease.
22685563 2012 Pollutant-induced modulation in conformation and ?-lactamase activity of human serum albumin.
22675238 2012 Human mature adipocytes express albumin and this expression is not regulated by inflammation.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22658569 2013 Plasma glycated albumin level and atherosclerosis: results from the Kyushu and Okinawa Population Study (KOPS).
22642562 2012 Ischemia-modified albumin (IMA): could it be useful to predict perinatal asphyxia?
22630368 2012 Insignificant role of the N-terminal cobalt-binding site of albumin in the assessment of acute coronary syndrome: discrepancy between the albumin cobalt-binding assay and N-terminal-targeted immunoassay.
22613267 2012 Detection of a novel splicing mutation causing analbuminemia in a Libyan family.
22549788 2012 Serum albumin prevents protein aggregation and amyloid formation and retains chaperone-like activity in the presence of physiological ligands.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22513409 2012 Interaction between two sulfate-conjugated uremic toxins, p-cresyl sulfate and indoxyl sulfate, during binding with human serum albumin.
22450170 2012 Modulation of the reactivity of the thiol of human serum albumin and its sulfenic derivative by fatty acids.
22440250 2012 Relationship between elevation of glycated albumin to glycated hemoglobin ratio in patients with a high bleeding risk of esophageal varices.
22437883 2012 Increased serum levels of ischemia-modified albumin and C-reactive protein in type 1 diabetes patients with ketoacidosis.
22351593 2012 Quantitative evaluation of the role of cysteine and methionine residues in the antioxidant activity of human serum albumin using recombinant mutants.
22306656 2012 5-Imino-1,2-4-thiadiazoles and quinazolines derivatives as glycogen synthase kinase 3? (GSK-3?) and phosphodiesterase 7 (PDE7) inhibitors: determination of blood-brain barrier penetration and binding to human serum albumin.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22244477 2013 Impact of elevated serum glycated albumin levels on contrast-induced acute kidney injury in diabetic patients with moderate to severe renal insufficiency undergoing coronary angiography.
22209935 2012 Human serum albumin as a new interacting partner of prolactin inducible protein in human seminal plasma.
22120732 2012 Albumin modification and fragmentation in renal disease.
21997768 2011 A fluorescent fatty acid probe, DAUDA, selectively displaces two myristates bound in human serum albumin.
21950461 2011 An FCS study of unfolding and refolding of CPM-labeled human serum albumin: role of ionic liquid.
21843484 2011 Do hydration dynamics follow the structural perturbation during thermal denaturation of a protein: a terahertz absorption study.
21635915 2011 Interaction studies of aristolochic acid I with human serum albumin and the binding site of aristolochic acid I in subdomain IIA.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21539799 2011 Characterization of the solution structure of human serum albumin loaded with a metal porphyrin and fatty acids.
21521316 2011 Leptin is better than any other biological parameter for monitoring the efficacy of renutrition in hospitalized malnourished elderly patients.
21494773 2011 Use of Raman spectroscopy for the identification of radical-mediated damages in human serum albumin.
21488149 2011 Histidine146 of human serum albumin plays a prominent role at the interface of subdomains IA and IIA in allosteric ligand binding.
21456469 2011 Diagnosis of ischemic heart disease using CK-MB, troponin-I and ischemia modified albumin.
21439346 2011 Binding of antitumor tamoxifen and its metabolites 4-hydroxytamoxifen and endoxifen to human serum albumin.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21326965 2010 Serum protein electrophoresis: any role in monitoring for antiretroviral therapy?
21276792 2011 Morphologic and proteomic characterization of exosomes released by cultured extravillous trophoblast cells.
21271345 2011 Lower albumin levels in African Americans at colon cancer diagnosis: a potential explanation for outcome disparities between groups?
21269460 2011 Initial characterization of the human central proteome.
21228463 2011 Human serum albumin as an antioxidant in the oxidation of (-)-epigallocatechin gallate: participation of reversible covalent binding for interaction and stabilization.
21193536 2011 Profiling Cys34 adducts of human serum albumin by fixed-step selected reaction monitoring.
21190670 2011 Stoichiometry and affinity of the human serum albumin-Alzheimer's A? peptide interactions.
21190025 2011 Low preoperative serum albumin in colon cancer: a risk factor for poor outcome.
20835227 2010 Checkpoint-dependent inhibition of DNA replication initiation by Sld3 and Dbf4 phosphorylation.
20828817 2011 Different prognostic factors for survival in acute and lymphomatous adult T-cell leukemia/lymphoma.
20818804 2010 Glycated albumin, a precursor of advanced glycation end-products, up-regulates NADPH oxidase and enhances oxidative stress in human endothelial cells: molecular correlate of diabetic vasculopathy.
20716240 2010 New genetic variant that might improve warfarin dose prediction in African Americans.
20705604 2010 ABCG2 transports and transfers heme to albumin through its large extracellular loop.
20692819 2010 Conformational modifications of serum albumins adsorbed on different kinds of biomimetic hydroxyapatite nanocrystals.
20603593 2010 [Clinical characteristics and ALB gene mutation analysis of Korean patients with bisalbuminemia].
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20381621 2010 Precipitation of human serum albumin from yeast culture liquid at pH values below 5.
20346571 2010 Allostery in a monomeric protein: the case of human serum albumin.
20306030 2010 Kinetics of stearic acid transfer between human serum albumin and sterically stabilized liposomes.
20215742 2010 The use of prealbumin concentration as a biomarker of nutritional status in treated phenylketonuric patients.
20211614 2010 Serum albumins and detoxication of anti-cholinesterase agents.
20171595 2010 Albumin Benkovac (c.1175 A > G; p.Glu392Gly): a novel genetic variant of human serum albumin.
20160662 2010 Enhanced albumin synthesis in severely burned adults.
20025859 2010 Location of the mutation site in the first two reported cases of analbuminemia.
20018855 2010 Cross-species binding analyses of mouse and human neonatal Fc receptor show dramatic differences in immunoglobulin G and albumin binding.
20018394 2010 Factors associated with impaired urinary albumin excretion in hypertensive individuals: albuminuria and hypertension.
20006594 2010 FcRn binding properties of an abnormal truncated analbuminemic albumin variant.
19996109 2010 Identification of human plasma proteins as major clients for the extracellular chaperone clusterin.
19955769 2010 Ischemia-modified albumin reduction after coronary bypass surgery is associated with the cardioprotective efficacy of cold-blood cardioplegia enriched with N-acetylcysteine: a preliminary study.
19884191 2010 Multiple conformational state of human serum albumin around single tryptophan residue at various pH revealed by time-resolved fluorescence spectroscopy.
19883602 2009 Human serum albumin inhibits Abeta fibrillization through a "monomer-competitor" mechanism.
19785033 2010 Exploration of human serum albumin binding sites by docking and molecular dynamics flexible ligand-protein interactions.
19734142 2009 Ibuprofen impairs allosterically peroxynitrite isomerization by ferric human serum heme-albumin.
19733855 2010 Cellular factors involved in CXCL8 expression induced by glycated serum albumin in vascular smooth muscle cells.
19711930 2009 Dynamics of loop 1 of domain I in human serum albumin when dissolved in ionic liquids.
19707690 2009 The role of an amino acid triad at the entrance of the heme pocket in human serum albumin for O(2) and CO binding to iron protoporphyrin IX.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19664386 2009 [Advanced glycation end products induce expression of PAI-1 in cultured human proximal tubular epithelial cells through NADPH oxidase dependent pathway].
19615354 2009 Association of serum glycated albumin, C-reactive protein and ICAM-1 levels with diffuse coronary artery disease in patients with type 2 diabetes mellitus.
19601929 2009 Structural basis of transport of lysophospholipids by human serum albumin.
19588173 2010 A study on the interaction between 5-Methyluridine and human serum albumin using fluorescence quenching method and molecular modeling.
19572666 2009 Influence of electrostatic interactions on the fibrillation process of human serum albumin.
19520864 2009 Structure, properties, and engineering of the major zinc binding site on human albumin.
19505594 2009 Influence of non-enzymatic post-translation modifications on the ability of human serum albumin to bind iron. Implications for non-transferrin-bound iron speciation.
19484197 2009 The anti-apoptotic activity of albumin for endothelium is inhibited by advanced glycation end products restricting intramolecular movement.
19450464 2009 Affinity and specificity of levamlodipine-human serum albumin interactions: insights into its carrier function.
19404566 2010 Influence of iron metabolism indices on glycated haemoglobin but not glycated albumin levels in premenopausal women.
19377253 2009 Elevated serum C-reactive protein level and microalbuminuria in patients with type 2 diabetes mellitus.
19375269 2009 Evaluation of ischemia-modified albumin in myocardial infarction and prostatic diseases.
19339807 2009 New horny layer marker proteins for evaluating skin condition in atopic dermatitis.
19318029 2009 Association between ischemia-modified albumin, lipids and inflammation biomarkers in patients with hypercholesterolemia.
19298387 2009 Allosteric and binding properties of Asp1-Glu382 truncated recombinant human serum albumin--an optical and NMR spectroscopic investigation.
19212124 2009 Focus on microalbuminuria to improve cardiac and renal protection.
19139584 2009 Binding properties of hydrophobic molecules to human serum albumin studied by fluorescence titration.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19021548 2008 Albumin as a zinc carrier: properties of its high-affinity zinc-binding site.
19011736 2008 Serum albumin at admission for prediction of functional outcome in ischaemic stroke patients.
18979581 2008 Effects of infliximab and parenteral nutrition on albumin and fibrinogen synthesis rates in pediatric Crohn disease.
18958405 2009 Investigating the movement of intravitreal human serum albumin nanoparticles in the vitreous and retina.
18791744 2009 Congenital analbuminemia with acute glomerulonephritis: a diagnostic challenge.
18579803 2008 Copper is taken up efficiently from albumin and alpha2-macroglobulin by cultured human cells by more than one mechanism.
18513410 2008 The value of ischemia-modified albumin compared with d-dimer in the diagnosis of pulmonary embolism.
18474236 2008 The antioxidant properties of serum albumin.
18464274 2009 Binding of cationic porphyrin to human serum albumin studied using comprehensive spectroscopic methods.
18459107 2008 Mutations and polymorphisms of the gene of the major human blood protein, serum albumin.
18386863 2008 Temperature-dependent simultaneous ligand binding in human serum albumin.
18346470 2008 Fatty acids influence binding of cobalt to serum albumin in patients with fatty liver.
18323672 2008 Significant association of serum albumin with severity of retinopathy and neuropathy, in addition to that of nephropathy, in Japanese type 2 diabetic patients.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18287254 2008 Serum albumin level and risk for mortality and hospitalization in adolescents on hemodialysis.
18256067 2008 Impairment of serum albumin antioxidant properties in obstructive sleep apnoea syndrome.
18200583 2008 Evaluation of ischemia-modified albumin in anemia associated to chronic kidney disease.
18200582 2008 Assay of ischemia-modified albumin and C-reactive protein for early diagnosis of acute coronary syndromes.
18192916 2008 Albumin mRNA in plasma predicts post-transplant recurrence of patients with hepatocellular carcinoma.
18178096 2008 Spectroscopic studies on the effect of temperature on pH-induced folded states of human serum albumin.
18068661 2008 Energetics of the interactions of human serum albumin with cationic surfactant.
18054940 2008 Association of ischemia-modified albumin and melatonin in patients with ST-elevation myocardial infarction.
18029235 2007 Changes of net charge and alpha-helical content affect the pharmacokinetic properties of human serum albumin.
18028874 2007 The binding constant for amyloid Abeta40 peptide interaction with human serum albumin.
17987802 2007 Reactive oxygen species damaged human serum albumin in patients with hepatocellular carcinoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17940721 2008 Effect of disease activity and position on autonomic nervous modulation in patients with systemic lupus erythematosus.
17603933 2007 Inhibition of the peroxidation of linoleic acid by the flavonoid quercetin within their complex with human serum albumin.
17587712 2007 Increased serum glycated albumin level is associated with the presence and severity of coronary artery disease in type 2 diabetic patients.
17575979 2007 Crystal structure of a bacterial albumin-binding domain at 1.4 A resolution.
17499233 2007 Association of serum levels of glycated albumin, C-reactive protein and tumor necrosis factor-alpha with the severity of coronary artery disease and renal impairment in patients with type 2 diabetes mellitus.
17467280 Release of the recombinant proteins, human serum albumin, beta-glucuronidase, glycoprotein B from human cytomegalovirus, and green fluorescent protein, in root exudates from transgenic tobacco and their effects on microbes and enzymatic activities in soil.
17460892 2007 [The targeting study of human serum albumin gene].
17438360 2007 The anti-apoptotic activity of albumin for endothelium is mediated by a partially cryptic protein domain and reduced by inhibitors of G-coupled protein and PI-3 kinase, but is independent of radical scavenging or bound lipid.
17347578 2007 Implications of levels of serum mineral metabolism markers, albumin and C-reactive protein for treatment costs of patients on maintenance dialysis.
17200780 2007 Immunization of LDL receptor-deficient mice with beta2-glycoprotein 1 or human serum albumin induces a more inflammatory phenotype in atherosclerotic plaques.
17184834 2007 Retinol and retinoic acid bind human serum albumin: stability and structural features.
17109502 2006 Alterations of biliary biochemical constituents and cytokines in infantile hepatitis syndrome.
17067818 2007 Effect of human serum albumin on drug metabolism: structural evidence of esterase activity of human serum albumin.
17064838 2007 A theoretical elucidation of bilirubin interaction with HSA's lysines: first electrostatic binding site in IIA subdomain.
17058928 2006 [Spectroscopic studies on the interactions of a hexadeca-carboxy zinc phthalocyanine and serum albumin and preparation of the bioconjugates].
17054386 2006 Resveratrol binding to human serum albumin.
17048876 2006 Amyloid fibril formation and other aggregate species formed by human serum albumin association.
17048273 2006 The conserved histidine 166 residue of the human neonatal Fc receptor heavy chain is critical for the pH-dependent binding to albumin.
17002873 2006 Conformational study of human serum albumin in pre-denaturation temperatures by differential scanning calorimetry, circular dichroism and UV spectroscopy.
16979183 2006 Chain length-dependent binding of fatty acid anions to human serum albumin studied by site-directed mutagenesis.
16939204 2006 Covalent adduction of human serum albumin by 4-hydroxy-2-nonenal: kinetic analysis of competing alkylation reactions.
16916777 2006 Urinary excretion of alpha1-microglobulin and albumin in acute myocardial infarction. Correlation with plasma concentrations of troponin I and C-reactive protein.
16892178 2006 Differentiation of human embryonic stem cells into hepatocytes in 2D and 3D culture systems in vitro.
16843720 2006 Fatty acids bound to human serum albumin and its structural variants modulate apolipoprotein B secretion in HepG2 cells.
16721655 2006 Calorimetric and binding dissections of HSA upon interaction with bilirubin.
16705651 2006 Interaction of (-)-epigallocatechin-3-gallate with human serum albumin: fluorescence, fourier transform infrared, circular dichroism, and docking studies.
16703327 2006 Diabetic nephropathy is associated with increased albumin and fibrinogen production in patients with type 2 diabetes.
16608438 2006 All-trans retinoic acid down-regulates human albumin gene expression through the induction of C/EBPbeta-LIP.
16454580 Influence of human serum albumin on photodegradation of folic acid in solution.
16413837 2006 Structural changes accompanying human serum albumin's binding of fatty acids are concerted.
16413740 2006 Study of the interaction of an anticancer drug with human and bovine serum albumin: spectroscopic approach.
16413734 2006 Binding studies of taxanes to human serum albumin by bioaffinity chromatography and circular dichroism.
16405401 2006 DNA interaction with human serum albumin studied by affinity capillary electrophoresis and FTIR spectroscopy.
16394536 2006 Human serum albumin enhances the hemolytic activity of Vibrio vulnificus.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16337614 2006 Ischemia-modified albumin increases after skeletal muscle ischemia during arthroscopic knee surgery.
16329499 2005 [Thermodynamics studies on the reaction characteristics of hemoporphyrin with human serum albumin].
16324740 2005 Unfolding pathways of human serum albumin: evidence for sequential unfolding and folding of its three domains.
16307046 2005 Kinetics of interaction of local anesthetics with human serum albumin.
16289007 2005 Determining molecular binding sites on human serum albumin by displacement of oleic acid.
16283771 Albumin clusters: structurally defined protein tetramer and oxygen carrier including thirty-two iron(II) porphyrins.
16253963 2006 Expression of human serum albumin (HSA) mRNA in human granulosa cells: potential correlation of the 95 amino acid long carboxyl terminal of HSA to gonadotrophin surge-attenuating factor.
16245148 2005 Production of human serum albumin by sugar starvation induced promoter and rice cell culture.
16213467 2005 Butyrylcholinesterase, paraoxonase, and albumin esterase, but not carboxylesterase, are present in human plasma.
16201370 2005 [The interaction of vitamin B6 with the human serum albumin].
16169013 2005 Structural basis of the drug-binding specificity of human serum albumin.
16159939 2005 Synthesis of thyroid hormone binding proteins transthyretin and albumin by human trophoblast.
16156788 2005 Allosteric modulation of myristate and Mn(III)heme binding to human serum albumin. Optical and NMR spectroscopy characterization.
16153637 2005 Albumin prevents mitochondrial depolarization and apoptosis elicited by endoplasmic reticulum calcium depletion of neuroblastoma cells.
16099937 2005 Analysis of albumin-associated peptides and proteins from ovarian cancer patients.
16054887 2005 The structure and function of oxidized albumin in hemodialysis patients: Its role in elevated oxidative stress via neutrophil burst.
16037246 2005 Peptide mapping of human serum albumin modified minimally by methylglyoxal in vitro and in vivo.
15996651 2005 Analbuminemia in a Swiss family is caused by a C --> T transition at nucleotide 4446 of the albumin gene.
15952740 Protein profiling of human pancreatic islets by two-dimensional gel electrophoresis and mass spectrometry.
15942949 2005 Specific interaction of chalcone-protein: cardamonin binding site II on the human serum albumin molecule.
15913893 2005 Site-directed mutagenesis study of the role of histidine residues in the neutral-to-basic transition of human serum albumin.
15890566 2005 Guanidine hydrochloride denaturation of human serum albumin originates by local unfolding of some stable loops in domain III.
15837789 2005 NMR analysis of synthetic human serum albumin alpha-helix 28 identifies structural distortion upon amadori modification.
15832324 2005 The effects of poly(ethylene glycol) on the solution structure of human serum albumin.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15740590 2005 In vivo and in vitro evidence for autocrine DCoH/HNF-1alpha transcription of albumin in the human epidermis.
15716124 2005 Binding of hypocrellin B to human serum albumin and photo-induced interactions.
15646839 Increased levels of albumin in bronchial washing fluid of patients with bronchial carcinoma. Could albumin be considered as a tumor marker?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15353599 2004 Ultrafast hydration dynamics in protein unfolding: human serum albumin.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15210122 2004 On the hydrodynamics and temperature dependence of the solution conformation of human serum albumin from viscometry approach.
15174051 2004 An investigation into the human serum "interactome".
15149953 2004 Postexercise protein metabolism in older and younger men following moderate-intensity aerobic exercise.
15137089 Dynamics of human serum albumin studied by acoustic relaxation spectroscopy.
15054046 2004 Proteomics applied to the clinical follow-up of patients after allogeneic hematopoietic stem cell transplantation.
15047055 2004 Enzymatic digestion and mass spectrometry in the study of advanced glycation end products/peptides.
14983239 2004 Serum albumin predicts cardiac adverse events in patients with advanced atherosclerosis - interrelation with traditional cardiovascular risk factors.
14759223 2004 Comparative binding character of two general anaesthetics for sites on human serum albumin.
14726550 2004 Human serum albumin and its N-terminal tetrapeptide (DAHK) block oxidant-induced neuronal death.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14687905 2004 A rapid, simple measurement of human albumin in whole blood using a fluorescence immunoassay (I).
14579113 2004 Organic anion transporting polypeptides of the OATP/ SLC21 family: phylogenetic classification as OATP/ SLCO superfamily, new nomenclature and molecular/functional properties.
14520007 2003 Extraction of uraemic toxins with activated carbon restores the functional properties of albumin.
13677478 Ligand binding to domain-3 of human serum albumin: a chemometric analysis.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12970360 2003 Human glycated albumin affects glucose metabolism in L6 skeletal muscle cells by impairing insulin-induced insulin receptor substrate (IRS) signaling through a protein kinase C alpha-mediated mechanism.
12969171 2003 Increased albumin and fibrinogen synthesis rate in patients with chronic renal failure.
12815038 2003 Albumin is a substrate of human chymase. Prediction by combinatorial peptide screening and development of a selective inhibitor based on the albumin cleavage site.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12617161 2002 Beyond expansion: structural studies on the transport roles of human serum albumin.
12566415 2003 The major histocompatibility complex-related Fc receptor for IgG (FcRn) binds albumin and prolongs its lifespan.
12480711 2003 Albumin activates the AKT signaling pathway and protects B-chronic lymphocytic leukemia cells from chlorambucil- and radiation-induced apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12118010 2002 The role of electrostatic interactions in human serum albumin binding and stabilization by halothane.
12009306 2002 Thermodynamic analysis of human serum albumin interactions with glucose: insights into the diabetic range of glucose concentration.
11847277 2002 Structural insights into human serum albumin-mediated prostaglandin catalysis.
11810025 Site-directed mutagenesis studies of human serum albumin define tryptophan at amino acid position 214 as the principal site for nitrosation.
11781148 2002 A novel splicing mutation causes an undescribed type of analbuminemia.
11743713 2001 Crystal structures of human serum albumin complexed with monounsaturated and polyunsaturated fatty acids.
11743520 2001 Congenital hypothyroidism in a child with unsuspected familial dysalbuminemic hyperthyroxinemia caused by a mutation (R218H) in the human albumin gene.
11680902 2001 Towards defining the urinary proteome using liquid chromatography-tandem mass spectrometry. I. Profiling an unfractionated tryptic digest.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
11168369 2001 A nucleotide insertion and frameshift cause albumin Kénitra, an extended and O-glycosylated mutant of human serum albumin with two additional disulfide bridges.
11159893 2001 Organic anion-transporting polypeptide B (OATP-B) and its functional comparison with three other OATPs of human liver.
11158855 2001 Mechanisms of albumin uptake by proximal tubular cells.
11145723 2001 HIV-1 Tat protein stimulates in vivo vascular permeability and lymphomononuclear cell recruitment.
11140838 2000 A multivariate analysis of 59 candidate genes in personality traits: the temperament and character inventory.
10940303 2000 Binding of the general anesthetics propofol and halothane to human serum albumin. High resolution crystal structures.
10811843 2000 Cubilin is an albumin binding protein important for renal tubular albumin reabsorption.
10780709 2000 HIV-1 Tat increases endothelial solute permeability through tyrosine kinase and mitogen-activated protein kinase-dependent pathways.
10388840 1999 Crystal structure of human serum albumin at 2.5 A resolution.
9731778 1998 Crystal structure of human serum albumin complexed with fatty acid reveals an asymmetric distribution of binding sites.
9618718 1998 Investigation of the 'fines' hypothesis of primary open-angle glaucoma: the possible role of alpha-crystallin.
9589637 1998 Familial dysalbuminemic hypertriiodothyroninemia: a new, dominantly inherited albumin defect.
9329347 1997 A novel missense mutation in codon 218 of the albumin gene in a distinct phenotype of familial dysalbuminemic hyperthyroxinemia in a Japanese kindred.
9183005 1997 Prothrombin, albumin and immunoglobulin A form covalent complexes with alpha1-microglobulin in human plasma.
8898021 1996 Megalin/gp330 mediates uptake of albumin in renal proximal tubule.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8513793 1993 The structural characterization and bilirubin-binding properties of albumin Herborn, a [Lys240-->Glu] albumin mutant.
8347685 1993 Albumin Hawkes Bay; a low level variant caused by loss of a sulphydryl group at position 177.
8134387 1994 A nucleotide insertion and frameshift cause analbuminemia in an Italian family.
8132774 1994 Molecular cloning, chromosomal localization, and functional characterization of a human liver Na+/bile acid cotransporter.
8064810 1994 A point mutation in the human serum albumin gene results in familial dysalbuminaemic hyperthyroxinaemia.
8063017 1994 The interaction of human serum albumin in the native and fully reduced states with apolipoprotein E, serum amyloid protein and very low density lipoproteins from human plasma.
8048949 1994 An identical missense mutation in the albumin gene results in familial dysalbuminemic hyperthyroxinemia in 8 unrelated families.
8022807 1994 Genetic variants of human serum albumin in Italy: point mutants and a carboxyl-terminal variant.
7902134 1993 Protein and DNA sequence analysis of a 'private' genetic variant: albumin Ortonovo (Glu-505-->Lys).
7895732 1994 The human myocardial two-dimensional gel protein database: update 1994.
7882997 1995 A genetic variant of albumin (albumin Asola; Tyr140-->Cys) with no free -SH group but with an additional disulfide bridge.
7852505 1995 Identification of a human serum albumin species associated with familial dysalbuminemic hyperthyroxinemia.
7578225 1995 Structural study of the glycosylated and unglycosylated forms of a genetic variant of human serum albumin (63 Asp-->Asn).
7557095 1995 Molecular and functional characterization of an organic anion transporting polypeptide cloned from human liver.
7297678 1981 Proalbumin Lille, a new variant of human serum albumin.
6933567 1980 Albumin Naskapi variant in North American Indians and Eti Turks.
6864486 1983 Kinetics of the rapid modification of human serum albumin with trinitrobenzenesulfonate and localization of its site.
6853480 1983 The principal site of nonenzymatic glycosylation of human serum albumin in vivo.
6706980 1984 Nonenzymatic glycosylation of human serum albumin alters its conformation and function.
6457647 1981 Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.
6324579 1984 Paraoxon hydrolysis in human serum mediated by a genetically variable arylesterase and albumin.
6292049 The human serum albumin gene: structure of a unique locus.
6275391 1982 Nucleotide sequence and the encoded amino acids of human serum albumin mRNA.
6192711 1983 Linkage of the evolutionarily-related serum albumin and alpha-fetoprotein genes within q11-22 of human chromosome 4.
6173750 1982 Familial dysalbuminemic hyperthyroxinemia: a syndrome that can be confused with thyrotoxicosis.
6171778 1981 The sequence of human serum albumin cDNA and its expression in E. coli.
4062880 1985 Masticatory lubrication. The role of carbohydrate in the lubricating property of a salivary glycoprotein-albumin complex.
4027254 1985 The molecular abnormality of albumin Parklands: 365 Asp----His.
3828358 1987 Albumin Canterbury (313 Lys----Asn). A point mutation in the second domain of serum albumin.
3795040 1986 Interaction between human serum albumin and alpha 1-acid glycoprotein in the binding of lidocaine to purified protein fractions and sera.
3759977 1986 Nonenzymatic glycosylation of albumin in vivo. Identification of multiple glycosylated sites.
3479777 1987 Amino acid substitutions in inherited albumin variants from Amerindian and Japanese populations.
3474609 1987 Amino acid substitutions in genetic variants of human serum albumin and in sequences inferred from molecular cloning.
3353369 1988 Splicing mutation in human hereditary analbuminemia.
3087352 1986 The amino acid sequence of kinetensin, a novel peptide isolated from pepsin-treated human plasma: homology with human serum albumin, neurotensin and angiotensin.
3081519 1986 Structural characterization of a chain termination mutant of human serum albumin.
3009475 1986 Molecular structure of the human albumin gene is revealed by nucleotide sequence within q11-22 of chromosome 4.
2914956 1989 The molecular defect in a COOH-terminal-modified and shortened mutant of human serum albumin.
2911589 1989 Identical structural changes in inherited albumin variants from different populations.
2901102 1988 The same substitution, glutamic acid----lysine at position 501, occurs in three alloalbumins of Asiatic origin: albumins Vancouver, Birmingham, and Adana.
2898383 1988 The amino acid substitution in albumin Roma: 321 Glu----Lys.
2792379 1989 A new proalbumin variant: albumin Jaffna (-1 Arg----Leu).
2762316 1989 Point substitutions in Japanese alloalbumins.
2727704 1989 Three-dimensional structure of human serum albumin.
2564675 1989 Amino acid substitutions in albumin variants found in Brazil.
2460858 1988 Purified hepatocyte nuclear factor 1 interacts with a family of hepatocyte-specific promoters.
2437111 1987 Structure of a biologically active neurotensin-related peptide obtained from pepsin-treated albumin(s).
2419329 1986 The human albumin gene. Characterization of the 5' and 3' flanking regions and the polymorphic gene transcripts.
2404284 1990 Point substitutions in albumin genetic variants from Asia.
2374930 1990 Structure of human serum albumin.
2339130 1990 Hypermutability of CpG dinucleotides in the propeptide-encoding sequence of the human albumin gene.
2247440 1990 Mutations in genetic variants of human serum albumin found in Italy.
2104980 1990 Albumin Redhill (-1 Arg, 320 Ala----Thr): a glycoprotein variant of human serum albumin whose precursor has an aberrant signal peptidase cleavage site.
2068071 1991 A donor splice mutation and a single-base deletion produce two carboxyl-terminal variants of human serum albumin.
1946412 1991 Genetic variants of serum albumin in Americans and Japanese.
1859851 1991 Structural characterization of a glycoprotein variant of human serum albumin: albumin Casebrook (494 Asp----Asn).
1819460 1991 Purification and structural study of two albumin variants in an Irish population.
1630489 1992 Atomic structure and chemistry of human serum albumin.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1518850 1992 Alloalbuminemia in Sweden: structural study and phenotypic distribution of nine albumin variants.
1390939 1992 Albumin Rugby Park: a truncated albumin variant caused by a G-->C splice-site mutation in intron 13.
1347703 1992 Two alloalbumins with identical electrophoretic mobility are produced by differently charged amino acid substitutions.
1225573 1975 Complete amino acid sequence of human serum albumin.
955075 1976 Lysine residue 199 of human serum albumin is modified by acetylsalicyclic acid.
683332 1978 A circulating variant of human proalbumin.
656055 1978 Lysine residue 240 of human serum albumin is involved in high-affinity binding of bilirubin.
571335 1979 Retinol-binding protein from human urine and its interaction with retinol and prealbumin.
325004 1977 Limited pepsin digestion of human plasma albumin.