Property Summary

Ligand Count 9
NCBI Gene PubMed Count 463
PubMed Score 98804.88
PubTator Score 5011.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hypertension 396 6.81 3.4
Pancreatitis 123 4.424 2.2
Thrombocytopenia 197 4.423 2.2
Uveitis 103 3.241 1.6
Urticaria 67 3.196 1.6
Acute kidney injury 70 0.0 0.0
Adenocarcinoma of lung 142 0.0 0.0
Angioedema 38 0.0 0.0
Anuria 9 0.0 0.0
Arthritis, Experimental 39 0.0 0.0
Azoospermia 110 0.0 0.0
Brain Diseases 24 0.0 0.0
Brain Injuries 65 0.0 0.0
Brain Ischemia 110 0.0 0.0
Cardiovascular Diseases 59 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Depressive disorder 409 0.0 0.0
Diabetic Angiopathies 16 0.0 0.0
Diabetic Nephropathies 37 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Drug-Related Side Effects and Adverse Reactions 62 0.0 0.0
Echinococcosis 26 0.0 0.0
Epilepsy 792 0.0 0.0
Fibrosis 44 0.0 0.0
Glomerulonephritis 46 0.0 0.0
Glomerulonephritis, Membranoproliferative 6 0.0 0.0
Glomerulonephritis, Membranous 7 0.0 0.0
HIV Infections 102 0.0 0.0
HIV Seropositivity 1 0.0 0.0
Heart Diseases 43 0.0 0.0
Heart failure 162 0.0 0.0
Hemolytic-Uremic Syndrome 30 0.0 0.0
Hepatitis 67 0.0 0.0
Hypersensitivity 63 0.0 0.0
Hypersensitivity, Delayed 1 0.0 0.0
Hyperthyroxinemia, Familial Dysalbuminemic 1 0.0 0.0
Hypoalbuminemia 24 0.0 0.0
Hypotension 82 0.0 0.0
Keloid 37 0.0 0.0
Kidney Diseases 114 0.0 0.0
Kidney Failure, Chronic 46 0.0 0.0
Liver Cirrhosis 181 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver Failure, Acute 29 0.0 0.0
Meningitis, Aseptic 2 0.0 0.0
Muscular Diseases 27 0.0 0.0
Myocardial Reperfusion Injury 37 0.0 0.0
Nephritis 51 0.0 0.0
Nephritis, Interstitial 10 0.0 0.0
Nephrosis 21 0.0 0.0
Nephrotic Syndrome 78 0.0 0.0
Occupational Diseases 12 0.0 0.0
Pain 103 0.0 0.0
Pancreatic Diseases 8 0.0 0.0
Poisoning 16 0.0 0.0
Proteinuria 144 0.0 0.0
Respiratory Distress Syndrome, Adult 40 0.0 0.0
Respiratory Tract Diseases 6 0.0 0.0
Rhinitis, Allergic, Perennial 1 0.0 0.0
Serum Sickness 1 0.0 0.0
Stevens-Johnson syndrome 92 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Stroke 33 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Liver cancer 604 0.0 0.5
Melanoma 711 0.0 0.6
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Kidney disease 430 8.26 4.0
diabetes mellitus 1728 7.512 3.8
Liver disease 237 7.317 3.7
Cancer 2499 6.574 3.3
Anemia 365 6.007 3.0
protein-energy malnutrition 8 6.004 3.0
Peritonitis 43 5.976 3.0
protein-losing enteropathy 12 5.789 2.9
Respiratory Failure 104 5.667 2.8
Portal hypertension 20 5.594 2.8
Cerebrovascular disease 238 5.529 2.8
Brain disease 96 5.517 2.8
Hepatitis B 108 5.516 2.8
Coronary artery disease 268 5.485 2.7
Heart disease 306 5.321 2.7
Bilirubin metabolic disorder 41 5.292 2.6
Atherosclerosis 291 5.259 2.6
Pneumonia 174 5.251 2.6
Hypersensitivity reaction type II disease 253 5.242 2.6
Diarrhea 253 5.213 2.6
Cholestasis 155 5.13 2.6
Diabetic retinopathy 56 5.118 2.6
Inflammatory bowel disease 151 5.091 2.5
Hyperglycemia 137 5.019 2.5
Esophageal varix 12 5.007 2.5
Obesity 678 4.995 2.5
Allergic hypersensitivity disease 126 4.907 2.5
Decubitus ulcer 13 4.87 2.4
Metabolic acidosis 90 4.845 2.4
Arthritis 290 4.821 2.4
Neuropathy 261 4.767 2.4
tuberculosis 2010 4.744 2.4
Varicose veins 20 4.716 2.4
Hyperparathyroidism 48 4.711 2.4
Peripheral vascular disease 87 4.692 2.3
Leukopenia 72 4.67 2.3
Hyperthyroxinemia 9 4.627 2.3
Lipid metabolism disorder 114 4.57 2.3
Asthma 385 4.562 2.3
Hepatitis C 94 4.545 2.3
Ovarian hyperstimulation syndrome 19 4.487 2.2
Cholangitis 32 4.256 2.1
Meningitis 67 4.231 2.1
Acquired immunodeficiency syndrome 197 4.23 2.1
Chronic obstructive pulmonary disease 184 4.225 2.1
Autonomic neuropathy 22 4.173 2.1
Hypercalcemia 59 4.16 2.1
Amyloidosis 67 4.147 2.1
Rhinitis 54 4.096 2.0
Arthus reaction 7 4.092 2.0
Intestinal Obstruction 31 4.085 2.0
Pulmonary embolism 55 4.083 2.0
Multiple Sclerosis 540 4.073 2.0
Neonatal Jaundice 30 4.057 2.0
Dementia 175 4.032 2.0
Portal vein thrombosis 12 3.995 2.0
Bronchitis 43 3.935 2.0
Acute cystitis 35 3.934 2.0
interstitial lung disease 298 3.926 2.0
Hyperphosphatemia 32 3.882 1.9
Kawasaki disease 28 3.866 1.9
Malaria 160 3.861 1.9
Hypothyroidism 122 3.84 1.9
Hyperhomocysteinemia 37 3.815 1.9
Tetanus 68 3.812 1.9
cystic fibrosis 1696 3.807 1.9
Pneumocystosis 17 3.787 1.9
Hyperuricemia 49 3.757 1.9
Short bowel syndrome 16 3.701 1.9
Vasculitis 80 3.661 1.8
Hyperthyroidism 53 3.655 1.8
Hypoglycemia 152 3.642 1.8
Mastitis 48 3.623 1.8
Fatty liver disease 103 3.612 1.8
Stomach disease 8 3.581 1.8
Alzheimer's disease 658 3.577 1.8
sarcoidosis 370 3.465 1.7
Schistosomiasis 35 3.452 1.7
Periodontal disease 40 3.408 1.7
Lymphedema 42 3.374 1.7
Exanthem 37 3.31 1.7
Leprosy 73 3.307 1.7
Dermatitis 157 3.293 1.6
Substance abuse 59 3.251 1.6
Diphtheria 40 3.225 1.6
Hypereosinophilic syndrome 71 3.21 1.6
Meningoencephalitis 13 3.207 1.6
Hypersplenism 10 3.204 1.6
Polyneuropathy 64 3.162 1.6
Tropical sprue 5 3.156 1.6
Capillary leak syndrome 4 3.15 1.6
Peptic ulcer disease 11 3.141 1.6
Hypertensive Retinopathy 14 3.14 1.6
Alcohol dependence 107 3.133 1.6
Thyrotoxicosis 38 3.105 1.6
Visceral leishmaniasis 14 3.1 1.5
Thrombophilia 38 3.097 1.5
Bronchiectasis 64 3.077 1.5
Toxic encephalopathy 141 3.055 1.5
Otitis Media 52 3.053 1.5
Primary immunodeficiency disease 54 3.032 1.5
Influenza 142 3.031 1.5
Hepatitis A 11 3.024 1.5

Expression

  Differential Expression (9)

See source...

PDB (100)

Gene RIF (344)

AA Sequence

MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEV      1 - 70
TEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLV     71 - 140
RPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELR    141 - 210
DEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADD    211 - 280
RADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVF    281 - 350
LGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFE    351 - 420
QLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEK    421 - 490
TPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHK    491 - 560
PKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGL                         561 - 609
//

Text Mined References (477)

PMID Year Title