Property Summary

NCBI Gene PubMed Count 24
PubMed Score 680.75
PubTator Score 123.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
esophageal adenocarcinoma -1.200 3.2e-02
glioblastoma -1.300 1.9e-04
medulloblastoma -1.200 6.3e-05
medulloblastoma, large-cell -2.200 3.1e-05
primitive neuroectodermal tumor -1.100 1.6e-03
pediatric high grade glioma -1.100 2.9e-05
subependymal giant cell astrocytoma -1.208 2.2e-02
spina bifida -1.505 4.0e-02
ovarian cancer -1.100 4.0e-05

Pathway (1)

Protein-protein Interaction (8)

Gene RIF (11)

PMID Text
26110528 AKTIP interacts with telomeric DNA and is required for telomere maintenance.
25151576 High fused toes homolog expression is associated with radioresistance in cervical cancer.
24971934 FTS silencing reduced EMT and cell migration by EGF treatment. These results demonstrate a novel function for FTS in EGF-mediated EMT process.
24022875 *AKTIP single nucleotide polymorphisms are not associated with late-onset depression patients compared to healthy elderly controls.
21424602 Targeted inhibition of FTS led to the shutdown of key elemental characteristics of cervical cancer and could lead to an effective therapeutic strategy.
20945372 These data unraveled the involvement of new oncoprotein FTS in cervical cancer which plays a central role in carcinogenesis.
20635389 Observational study of gene-disease association. (HuGE Navigator)
20132317 Demographic and clinical characteristics and AKT1 single markers and haplotypes, but not AKTIP polymorphisms or interactions between AKT1 and AKTIP, are associated with increased risk for suicidal behavior in bipolar patients.
19270026 Observational study of gene-disease association. (HuGE Navigator)
18799622 These data suggest that the FTS/Hook/FHIP complex functions to promote vesicle trafficking and/or fusion via the homotypic vacuolar protein sorting complex.
14749367 Ft1 protein interacts directly with PKB, enhancing the phosphorylation of both of its regulatory sites by promoting its interaction with the upstream kinase PDK1

AA Sequence

MNPFWSMSTSSVRKRSEGEEKTLTGDVKTSPPRTAPKKQLPSIPKNALPITKPTSPAPAAQSTNGTHASY      1 - 70
GPFYLEYSLLAEFTLVVKQKLPGVYVQPSYRSALMWFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRL     71 - 140
VFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTASPLNPEAAVLYEKDIQLFK    141 - 210
SKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSV    211 - 280
QPFSKEEKTVAT                                                              281 - 292
//

Text Mined References (25)

PMID Year Title
26110528 2015 AKTIP/Ft1, a New Shelterin-Interacting Factor Required for Telomere Maintenance.
25416956 2014 A proteome-scale map of the human interactome network.
25151576 2015 FTS is responsible for radiation-induced nuclear phosphorylation of EGFR and repair of DNA damage in cervical cancer cells.
24971934 2014 EGF-induced expression of Fused Toes Homolog (FTS) facilitates epithelial-mesenchymal transition and promotes cell migration in ME180 cervical cancer cells.
24022875 2014 Genetic variant of AKT1 and AKTIP associated with late-onset depression in a Brazilian population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21424602 2011 Fused Toes Homolog modulates radiation cytotoxicity in uterine cervical cancer cells.
20945372 2011 FTS (fused toes homolog) a novel oncoprotein involved in uterine cervical carcinogenesis and a potential diagnostic marker for cervical cancer.
20635389 2011 Common alleles in candidate susceptibility genes associated with risk and development of epithelial ovarian cancer.
20132317 2010 Association between AKT1 but not AKTIP genetic variants and increased risk for suicidal behavior in bipolar patients.
19270026 2009 Functional complementation studies identify candidate genes and common genetic variants associated with ovarian cancer survival.
18799622 2008 An FTS/Hook/p107(FHIP) complex interacts with and promotes endosomal clustering by the homotypic vacuolar protein sorting complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14749367 2004 Regulation of apoptosis by the Ft1 protein, a new modulator of protein kinase B/Akt.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9501314 1998 Close linkage of p130 and Ft1 is conserved among mammals.
9383278 1997 Ft1, a novel gene related to ubiquitin-conjugating enzymes, is deleted in the Fused toes mouse mutation.
8626685 1996 A cDNA encoding the calcitonin gene-related peptide type 1 receptor.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.