Property Summary

NCBI Gene PubMed Count 116
PubMed Score 460.54
PubTator Score 111.02

Knowledge Summary

Patent (35,454)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 1.0

Expression

  Differential Expression (26)

Disease log2 FC p
psoriasis -1.600 5.2e-04
glioblastoma multiforme -1.100 2.1e-20
osteosarcoma -2.164 5.1e-04
cystic fibrosis -1.114 4.8e-05
medulloblastoma, large-cell 1.500 1.3e-02
adrenocortical carcinoma -1.439 2.3e-04
tuberculosis and treatment for 6 months -1.600 3.0e-04
intraductal papillary-mucinous adenoma (... -2.700 2.8e-05
intraductal papillary-mucinous carcinoma... -3.100 3.1e-05
intraductal papillary-mucinous neoplasm ... -2.100 1.2e-02
colon cancer -2.000 3.2e-02
lung cancer 1.400 2.1e-03
lung adenocarcinoma -1.565 5.5e-10
adult high grade glioma -1.300 5.4e-04
group 4 medulloblastoma 1.500 3.0e-03
posterior fossa group B ependymoma -1.200 2.9e-06
non primary Sjogren syndrome sicca -1.400 2.3e-02
nasopharyngeal carcinoma 1.300 3.3e-04
non-small cell lung carcinoma -1.300 2.3e-31
spina bifida 1.176 3.7e-02
Breast cancer -2.200 1.3e-14
invasive ductal carcinoma -1.900 5.1e-04
acute myeloid leukemia -3.100 1.7e-02
ulcerative colitis 1.300 5.0e-05
ovarian cancer -3.200 1.1e-11
pituitary cancer 1.200 4.5e-09

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (111)

PMID Text
26855332 Akt1 and Akt2 activated both SREBP-1 and SREBP-2, whereas Akt3 upregulated SREBP-1 to enhance hepatitis C virus translation.
26741489 Downregulation of AKT3 increases migration and metastasis in triple negative breast cancer cells by upregulating S100A4.
26523971 These findings suggest a central AKT-FOXG1-reelin signaling pathway in focal malformations of cortical development and support pathway inhibitors as potential treatments or therapies for some forms of focal epilepsy.
26512921 High AKT3 expression is associated with ovarian cancer.
26427440 Data show that both serine/threonine phosphatases PHLPP and dephosphorylated the physiological substrates of Akt1 and Akt3 with similar efficiencies.
26318033 AKT3 has a role in prostate cancer proliferation through regulation of Akt, B-Raf, and TSC1/TSC2
26315541 mirn424 has a role in inhibiting Akt3/E2F3 axis and tumor growth in hepatocellular carcinoma
26206082 Flot-2 exerts a pro-neoplastic role in NPC and is involved in tumor progression and metastasis. Moreover, Flot-2 exerts its role through NF-kappaB and PI3K/Akt3 signaling.
26002580 miR-582-5p regulated the progression of hepatocellular carcinoma through directly inhibiting the expression of CDK1 and AKT3, and indirectly inhibiting the expression of cyclinD1
25737557 Akt3-expressing human glioblastoma cells had enhanced activation of DNA repair proteins, leading to increased DNA repair and subsequent resistance to radiation and temozolomide.
25722288 findings identify PI3K/AKT pathway mutations as an important cause of epileptogenic brain malformations and establish megalencephaly, hemimegalencephaly, and focal cortical dysplasia as part of a single pathogenic spectrum.
25501707 AKT3, PI3KCA, and VEGFR2 silencing reduces the invasiveness of glioblastoma multiforme T98G cells.
25424989 A 1q44 deletion involving only AKT3 in a boy and his father, is reported.
25388284 Mechanistic investigations uncovered opposing functions for different Akt isoforms in this regulation, where Akt1 promotes and Akt3 inhibits vascular tumor growth.
25323119 MiR-22 induces EPC senescence by downregulating AKT3 expression.
25246356 The individual contribution of each Akt isoform in p120 RasGAP fragment N-mediated cell protection against Fas ligand induced cell death, was investigated.
25233414 Data suggest that three isoforms of the serine/threonine protein kinase Akt (Akt1, Akt2, Akt3) regulate cell survival, cell growth, cell proliferation, and cell metabolism in breast cancer cells. [REVIEW]
25122428 The PI3K/AKT/mTOR pathway is distinguishable in SCLC genomic alterations. Therefore, a sequencing-based comprehensive analysis could stratify SCLC patients by potential therapeutic targets.
25104021 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
25091978 These findings indicate that AKT3 upregulation may cause focal malformations of cortical development.
24967401 Knockdown of AKT3 and/or PI3KCA genes in T98G cells led to a significant reduction in cell viability, the accumulation of subG1-phase cells and, a reduced fraction of cells in the S and G2/M phases.
24942865 Akt3 is a negative regulator of IGFBP-3 protein.
24781864 miR-145 suppresses thyroid cancer growth and metastasis and targets AKT3
24686007 miR-489 inhibited cisplatin resistance and cell growth, and promotes apoptosis by suppressing Akt3 expression.
24658403 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
24469921 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
24463007 Inactivation of AKT3 in ErbB2+/ERalpha- breast cancer cells results in decreased expression of ErbB2 and ErbB3, but increased expression of ERalpha.
24462114 IWS1, an RNA processing regulator, is phosphorylated by Akt3 and Akt1 at Ser720/Thr721 in lung cancer
24335962 targeting Akt3 and downstream signaling may be an effective approach to inhibit growth of triple-negative breast cancer (TNBC0.
24247267 Experimental validation indicate that AKT1, AKT2 and AKT3 proteins may all be novel unfavorable prognostic factors for patients with hepatocellular carcinoma.
24244375 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
24225433 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
24138071 Our study revealed AKT-3 amplification and deletions in 11% (9/82) and 13% (11/82) of triple-negative breast cancers, respectively.
24039187 Various AKT3 mutations are important in neurological disorders, such as microcephaly, hemimegalencephaly, and megalencephaly syndromes
23929892 detected and measured all three AKT isoforms 1, 2 and 3 to enable the study of the multiple and variable roles that these isoforms play in AKT breast tumorigenesis
23873136 Induction of transgenic Akt3 constitutively activates pathways for survival by counteracting motor neuronal degeneration in patients with amyotrophic lateral sclerosis.
23811558 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
23794269 Duplication of AKT3 causes macrocephaly.
23746211 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
23742646 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
23604117 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
23603119 Akt3 coimmunoprecipitates with Ago2.
23303682 AKT isoforms 1 and 3 promote basal as well as EGF-induced trophoblast migration.
23301033 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
23251686 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
23077641 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
22904195 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
22729570 AKT3, ANGPTL4, eNOS3, and VEGFA associations with high altitude sickness in Han and Tibetan Chinese at the Qinghai-Tibetan Plateau.
22729224 identified mutations in AKT3, PIK3R2 and PIK3CA in 11 unrelated families with megalencephaly-capillary malformation and megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndromes
22729223 Exome sequencing and mass spectrometry analysis in paired brain-blood samples from individuals with hemimegalencephaly (20 cases) identified de novo somatic mutations in 30% of affected individuals in the PIK3CA, AKT3 and MTOR genes.
22500628 This study identifies a trisomy on chromosome 1q, which encompasses AKT3, and a separate activating AKT3 somatic mutation in patients with the developmental brain disorder hemimegalencephaly.
22262409 In hepatocellular carcinoma miR-519d is up-regulated by p53 and DNA hypomethylation and targets CDKN1A/p21, PTEN, AKT3 and TIMP2.
22234583 Resveratrol down-regulates the protein cyclin D1 and, in a concentration dependent manner, the phosphorylation levels of protein kinase B and glycogen synthase kinase-3beta in OVCAR-3 ovarian cancer cells.
22107784 The prognostic impact of Akt (Akt1) phosphorylated at threonine308 and serine473, Akt2, Akt3, PI3K and PTEN, alone and in coexpression with ER and PgR in non-gastrointestinal stromal tumor soft tissue sarcomas.
21821713 Akt3 plays an important and distinct role in platelet activation and in thrombosis.
21777670 Our data demonstrate that Akt1 and notably Akt3 regulate proliferation, survival, migration and EGF-mediated signal transduction in NSCLC-derived DTC
21765914 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
21763505 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
21697490 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
21606541 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
21590431 Transcriptional activation of the Akt3 pathway indicates that it is involved in lumbar disc degeneration.
21507933 Akt3 was required for anchorage-independent growth of transformed astrocytes and human glioma cells
21487925 We did not find any mutation in the GNAQ, AKT3, and PIK3R1 genes in various types of thyroid cancer.
21483469 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
21423810 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
21351097 These findings suggest an important role for Akt3 in the regulation of RCAS1 and VEGF secretion in ovarian cancer cells.
21191416 Expression of matrix metalloproteinase-13 is controlled by IL-13 via PI3K/Akt3 and PKC-delta in normal human dermal fibroblasts.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21029719 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
20980808 No AKT3 E17K mutation was detected in the 73 squamous cell carcinomas of the lung
20818790 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
20661303 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
20647317 Mutant B-RAF melanoma cells ectopically expressing a constitutively activated form of Akt3 or endogenously expressing mutant Akt3 were protected from apoptosis induced by B-RAF knockdown or PLX4720 treatment.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20398329 Studies indicate that three different isoforms Akt1, Akt2, and Akt3 have distinct expression patterns and functions.
20354165 Observational study of gene-disease association. (HuGE Navigator)
20186503 We evaluated the presence of mutations in PIK3CA, AKT1, AKT2, AKT3, PTEN, and PDPK1 genes in 83 papillary thyroid carcinomas
20186503 Observational study of gene-disease association. (HuGE Navigator)
20167810 Our data suggest that Akt2 and Akt3 play an important role in the viability of human malignant glioma cells
20102399 In breast cancer AKT3 amplifications and AKT1 and AKT2 deletions were seen by FISH
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20018949 Akt3 was located in the nucleus and nuclear membrane of human cell lines.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19626040 Observational study of gene-disease association. (HuGE Navigator)
19435822 Findings indicate that AP-1 has an important function in pancreatic cancer cells and provide evidence for a previously unknown Akt-mediated mechanism of c-Jun activation.
19261608 Bcr-Abl represses the expression of PHLPP1 and PHLPP2 and continuously activates Akt1, -2, and -3 via phosphorylation on Ser-473, resulting in the proliferation of CML cells
18826950 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
18813315 the first report of AKT mutations in melanoma, and the initial identification of an AKT3 mutation in any human cancer lineage
18451171 Akt3 and mutant V600E B-Raf cooperate to promote early melanoma development.
18300076 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
17895832 PKB[alpha] and/or PKB[gamma] and not PKB[beta] alone are involved in gemcitabine resistance mechanisms.
17668379 AKT3 represents an excellent candidate for developmental human MIC and ACC, and we suggest that haploinsufficiency causes both postnatal MIC and ACC.
17178867 AKT3 is highly expressed in 19 of 92 primary ovarian tumors, consistent with AKT3 playing a key role in the genesis of at least one subset of ovarian cancers.
17157319 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
16841089 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
16524887 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
15987444 in breast cancer patients, Akt activation is associated with tumour proliferation and poor prognosis, particularly in the subset of patients with ErbB2-overexpressing tumours
15698844 activation of Akt signaling results in progression from adaptive to maladaptive cardiac hypertrophy
15689238 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
15616007 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
15579468 Rac1, PI3 kinase, and Akt3 have roles in an anti-apoptotic pathway triggered by ALS2 that antagonizes SOD1 mutant-induced motoneuronal cell death
15543611 Dysregulation of the PI 3-K/AKT/PTEN pathway may contribute to early head neck squamous cell carcinoma tumorigenesis.
15466193 Targeted reduction of Akt3 activity with siRNA or by expressing active PTEN protein stimulated apoptotic signaling, which reduced cell survival by increasing apoptosis rates thereby inhibiting melanoma tumor development.
14637150 The above results indicate that PKB-Ser-473 and FAK-Tyr phosphorylation stimulated by TGF-beta1 are both dependent on cell adhesion.
12692267 The regulation by Akt3 was found to be due to two specific regions in the Fra-1 regulatory sequence which match Sp1 consensus sites
12663464 results show that a defect in the ability of insulin to activate Akt-2 and -3 may explain the impaired insulin-stimulated glucose transport in insulin resistance
11994280 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
11208609 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
11156964 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
10869418 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells
9394803 HIV-1 Nef synergizes with KSHV oncoprotein K1 to activate PI3K/AKT/mTOR signaling pathway, and induces cell proliferation and microtubule formation in endothelial cells

AA Sequence

MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPN      1 - 70
TFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHH     71 - 140
KRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTS    141 - 210
LKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLD    211 - 280
KDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQD    281 - 350
HEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP    351 - 420
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE               421 - 479
//

Text Mined References (126)

PMID Year Title
26855332 2016 PI3K-Akt signaling pathway upregulates hepatitis C virus RNA translation through the activation of SREBPs.
26741489 2016 Downregulation of AKT3 Increases Migration and Metastasis in Triple Negative Breast Cancer Cells by Upregulating S100A4.
26523971 2015 An AKT3-FOXG1-reelin network underlies defective migration in human focal malformations of cortical development.
26512921 2015 MicroRNA-29B (mir-29b) regulates the Warburg effect in ovarian cancer by targeting AKT2 and AKT3.
26427440 2016 Photoreceptor Neuroprotection: Regulation of Akt Activation Through Serine/Threonine Phosphatases, PHLPP and PHLPPL.
26318033 2015 AKT3 promotes prostate cancer proliferation cells through regulation of Akt, B-Raf, and TSC1/TSC2.
26315541 2015 MicroRNA-424 inhibits Akt3/E2F3 axis and tumor growth in hepatocellular carcinoma.
26206082 2015 Flotillin-2 promotes metastasis of nasopharyngeal carcinoma by activating NF-?B and PI3K/Akt3 signaling pathways.
26002580 2015 miR-582-5p inhibits proliferation of hepatocellular carcinoma by targeting CDK1 and AKT3.
25737557 2015 Genomically amplified Akt3 activates DNA repair pathway and promotes glioma progression.
25722288 2015 PI3K/AKT pathway mutations cause a spectrum of brain malformations from megalencephaly to focal cortical dysplasia.
25501707 2015 Knockdown of the AKT3 (PKB?), PI3KCA, and VEGFR2 genes by RNA interference suppresses glioblastoma multiforme T98G cells invasiveness in vitro.
25424989 2015 Phenotypes of AKT3 deletion: a case report and literature review.
25388284 2015 Akt1 and akt3 exert opposing roles in the regulation of vascular tumor growth.
25323119 2014 MicroRNA-22 induces endothelial progenitor cell senescence by targeting AKT3.
25246356 2014 The activity of the anti-apoptotic fragment generated by the caspase-3/p120 RasGAP stress-sensing module displays strict Akt isoform specificity.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25233414 2014 Signalling specificity in the Akt pathway in breast cancer.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25122428 2014 Therapeutic priority of the PI3K/AKT/mTOR pathway in small cell lung cancers as revealed by a comprehensive genomic analysis.
25091978 2015 Focal dysplasia of the cerebral cortex and infantile spasms associated with somatic 1q21.1-q44 duplication including the AKT3 gene.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24967401 2014 Knockdown of AKT3 (PKB?) and PI3KCA suppresses cell viability and proliferation and induces the apoptosis of glioblastoma multiforme T98G cells.
24942865 2014 Transcriptional and posttranslational regulation of insulin-like growth factor binding protein-3 by Akt3.
24781864 2014 miR-145 suppresses thyroid cancer growth and metastasis and targets AKT3.
24686007 2014 MiR-489 modulates cisplatin resistance in human ovarian cancer cells by targeting Akt3.
24463007 2014 AKT3 regulates ErbB2, ErbB3 and estrogen receptor ? expression and contributes to endocrine therapy resistance of ErbB2(+) breast tumor cells from Balb-neuT mice.
24462114 2014 Phosphoproteomics screen reveals akt isoform-specific signals linking RNA processing to lung cancer.
24335962 2014 Targeting Akt3 signaling in triple-negative breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247267 2014 Identification of AKT kinases as unfavorable prognostic factors for hepatocellular carcinoma by a combination of expression profile, interaction network analysis and clinical validation.
24138071 2014 Investigation of molecular alterations of AKT-3 in triple-negative breast cancer.
24039187 2013 The AKT genes and their roles in various disorders.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23929892 2013 Identification and quantification of AKT isoforms and phosphoforms in breast cancer using a novel nanofluidic immunoassay.
23873136 2014 Specific induction of Akt3 in spinal cord motor neurons is neuroprotective in a mouse model of familial amyotrophic lateral sclerosis.
23794269 2013 Duplication of AKT3 as a cause of macrocephaly in duplication 1q43q44.
23745724 2014 AKT3 and PIK3R2 mutations in two patients with megalencephaly-related syndromes: MCAP and MPPH.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
23603119 2013 Akt-mediated phosphorylation of argonaute 2 downregulates cleavage and upregulates translational repression of MicroRNA targets.
23599027 2013 Genome-wide association study of age at menarche in African-American women.
23303682 2013 AKT isoforms 1 and 3 regulate basal and epidermal growth factor-stimulated SGHPL-5 trophoblast cell migration in humans.
22729570 2012 AKT3, ANGPTL4, eNOS3, and VEGFA associations with high altitude sickness in Han and Tibetan Chinese at the Qinghai-Tibetan Plateau.
22729224 2012 De novo germline and postzygotic mutations in AKT3, PIK3R2 and PIK3CA cause a spectrum of related megalencephaly syndromes.
22729223 2012 De novo somatic mutations in components of the PI3K-AKT3-mTOR pathway cause hemimegalencephaly.
22500628 2012 Somatic activation of AKT3 causes hemispheric developmental brain malformations.
22262409 2012 In hepatocellular carcinoma miR-519d is up-regulated by p53 and DNA hypomethylation and targets CDKN1A/p21, PTEN, AKT3 and TIMP2.
22234583 2012 Resveratrol downregulates Akt/GSK and ERK signalling pathways in OVCAR-3 ovarian cancer cells.
22107784 2011 The prognostic impact of Akt isoforms, PI3K and PTEN related to female steroid hormone receptors in soft tissue sarcomas.
21821713 2011 An important role for Akt3 in platelet activation and thrombosis.
21777670 2011 Distinct functional roles of Akt isoforms for proliferation, survival, migration and EGF-mediated signalling in lung cancer derived disseminated tumor cells.
21620960 2011 Akt signalling in health and disease.
21590431 2011 Akt/PKB isoforms expression in the human lumbar herniated disc: correlation with clinical and MRI findings.
21507933 2011 Nonredundant functions for Akt isoforms in astrocyte growth and gliomagenesis in an orthotopic transplantation model.
21487925 2011 Uncommon GNAQ, MMP8, AKT3, EGFR, and PIK3R1 mutations in thyroid cancers.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21351097 2012 Akt3 controls vascular endothelial growth factor secretion and angiogenesis in ovarian cancer cells.
21269460 2011 Initial characterization of the human central proteome.
21191416 2011 Expression of matrix metalloproteinase-13 is controlled by IL-13 via PI3K/Akt3 and PKC-? in normal human dermal fibroblasts.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20980808 2010 Rarity of AKT1 and AKT3 E17K mutations in squamous cell carcinoma of lung.
20647317 2010 Akt3-mediated resistance to apoptosis in B-RAF-targeted melanoma cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20398329 2010 Key signalling nodes in mammary gland development and cancer. Signalling downstream of PI3 kinase in mammary epithelium: a play in 3 Akts.
20354165 2010 Energy balance, the PI3K-AKT-mTOR pathway genes, and the risk of bladder cancer.
20186503 2010 Mutational and immunohistochemical study of the PI3K/Akt pathway in papillary thyroid carcinoma in Greece.
20167810 2010 Akt2 and Akt3 play a pivotal role in malignant gliomas.
20102399 2010 Molecular alterations in AKT1, AKT2 and AKT3 detected in breast and prostatic cancer by FISH.
20059950 2009 The E3 ligase TTC3 facilitates ubiquitination and degradation of phosphorylated Akt.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20031603 2009 A genome-wide association scan of RR and QT interval duration in 3 European genetically isolated populations: the EUROSPAN project.
20018949 2010 The Akt isoforms are present at distinct subcellular locations.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19713527 2009 The E3 ligase TRAF6 regulates Akt ubiquitination and activation.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
19435822 2009 Activator protein-1 has an essential role in pancreatic cancer cells and is regulated by a novel Akt-mediated mechanism.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19261608 2009 Depletion of Pleckstrin homology domain leucine-rich repeat protein phosphatases 1 and 2 by Bcr-Abl promotes chronic myelogenous leukemia cell proliferation through continuous phosphorylation of Akt isoforms.
18813315 2008 A novel AKT3 mutation in melanoma tumours and cell lines.
18524868 2008 VEGF stimulation of mitochondrial biogenesis: requirement of AKT3 kinase.
18451171 2008 Akt3 and mutant V600E B-Raf cooperate to promote early melanoma development.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17895832 2007 Dissociation of gemcitabine sensitivity and protein kinase B signaling in pancreatic ductal adenocarcinoma models.
17668379 2007 Mapping of deletion and translocation breakpoints in 1q44 implicates the serine/threonine kinase AKT3 in postnatal microcephaly and agenesis of the corpus callosum.
17544405 2007 Caspase-3-mediated cleavage of Akt: involvement of non-consensus sites and influence of phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17178867 2006 A specific role for AKT3 in the genesis of ovarian cancer through modulation of G(2)-M phase transition.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16540465 2006 Kinetic mechanism of AKT/PKB enzyme family.
16381901 2006 The LIFEdb database in 2006.
15987444 2005 Increased level of phosphorylated akt measured by chemiluminescence-linked immunosorbent assay is a predictor of poor prognosis in primary breast cancer overexpressing ErbB-2.
15698844 2005 Akt3 overexpression in the heart results in progression from adaptive to maladaptive hypertrophy.
15579468 2005 A Rac1/phosphatidylinositol 3-kinase/Akt3 anti-apoptotic pathway, triggered by AlsinLF, the product of the ALS2 gene, antagonizes Cu/Zn-superoxide dismutase (SOD1) mutant-induced motoneuronal cell death.
15543611 2005 Frequent genetic and biochemical alterations of the PI 3-K/AKT/PTEN pathway in head and neck squamous cell carcinoma.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466193 2004 Deregulated Akt3 activity promotes development of malignant melanoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14637150 2003 Transforming growth factor-beta1 stimulated protein kinase B serine-473 and focal adhesion kinase tyrosine phosphorylation dependent on cell adhesion in human hepatocellular carcinoma SMMC-7721 cells.
12692267 2003 Gene expression profiling in prostate cancer cells with Akt activation reveals Fra-1 as an Akt-inducible gene.
12663464 2003 Defective signaling through Akt-2 and -3 but not Akt-1 in insulin-resistant human skeletal muscle: potential role in insulin resistance.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176997 2002 Akt forms an intracellular complex with heat shock protein 90 (Hsp90) and Cdc37 and is destabilized by inhibitors of Hsp90 function.
12162751 2002 Characterization of PDK2 activity against protein kinase B gamma.
11994280 2002 HIV-1-Tat protein activates phosphatidylinositol 3-kinase/ AKT-dependent survival pathways in Kaposi's sarcoma cells.
11839817 2002 Identification of Akt association and oligomerization domains of the Akt kinase coactivator TCL1.
11707444 2002 Differential regulation of Akt kinase isoforms by the members of the TCL1 oncogene family.
11489829 2001 AKT-1, -2, and -3 are expressed in both normal and tumor tissues of the lung, breast, prostate, and colon.
11466625 2001 Oncogenic transformation induced by membrane-targeted Akt2 and Akt3.
11387345 2001 Two splice variants of protein kinase B gamma have different regulatory capacity depending on the presence or absence of the regulatory phosphorylation site serine 472 in the carboxyl-terminal hydrophobic domain.
11322783 2001 Enhanced stimulation of Akt-3/protein kinase B-gamma in human aortic smooth muscle cells.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10773662 2000 Mapping of AKT3, encoding a member of the Akt/protein kinase B family, to human and rodent chromosomes by fluorescence in situ hybridization.
10491192 1999 Molecular cloning, expression and characterization of the human serine/threonine kinase Akt-3.
10419456 1999 Up-regulation of Akt3 in estrogen receptor-deficient breast cancers and androgen-independent prostate cancer lines.
10208883 1999 Identification of a human Akt3 (protein kinase B gamma) which contains the regulatory serine phosphorylation site.
10092583 1999 A human protein kinase Bgamma with regulatory phosphorylation sites in the activation loop and in the C-terminal hydrophobic domain.
9512493 1998 Activation of protein kinase B beta and gamma isoforms by insulin in vivo and by 3-phosphoinositide-dependent protein kinase-1 in vitro: comparison with protein kinase B alpha.
9394803 1997 Extracellular HIV-1 Tat protein activates phosphatidylinositol 3- and Akt/PKB kinases in CD4+ T lymphoblastoid Jurkat cells.
9305920 1997 Identification of serine 643 of protein kinase C-delta as an important autophosphorylation site for its enzymatic activity.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.