Property Summary

NCBI Gene PubMed Count 34
PubMed Score 165.24
PubTator Score 54.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.417 8.3e-04
atypical teratoid / rhabdoid tumor 1.400 1.5e-06
glioblastoma 1.600 3.3e-05
pediatric high grade glioma 1.200 1.1e-03
Polycystic Ovary Syndrome -1.204 2.9e-02

Protein-protein Interaction (11)

Gene RIF (21)

PMID Text
26003731 This review discusses the role of PRAS40 and possible feedback mechanisms, and alterations in AKT/PRAS40/mTOR signaling that have been implicated in the pathogenesis of tumor progression. [review]
25648575 The frameshift mutation detected in the current study would result in a premature stop of amino-acid synthesis in AKT1S1 protein and hence resembles a typical loss-of-function mutation.
25531317 Supporting this idea, we identified a downstream target of the TGFb-miR-96 signaling pathway to be AKT1S1 mRNA, whose translated protein is a negative regulator of mTOR kinase.
24704832 Findings indicate that dual phosphorylation of PRAS40 by Akt and mTORC1 promotes formation of a nuclear-specific PRAS40- and RPL11-containing complex distinct from mTORC1 that inhibits the RPL11-HDM2-p53 pathway.
24576065 PRAS40 as a regulator of insulin sensitivity in hSkMC
23712034 PRAS40 contains a functional nuclear export signal. Furthermore, enforced nuclear accumulation of PRAS40 impairs insulin action, thereby substantiating the function of this protein in the regulation of insulin sensitivity.
23460019 Data suggest that PRAS40 modulates insulin action in skeletal muscle; knockdown of PRAS40 inhibits insulin action in cultured myotubes and is associated with up-regulation of IRS1 (insulin receptor substrate 1) degradation via proteasome proteolysis.
22873724 WISP1 governs PRAS40 by sequestering PRAS40 intracellularly through post-translational phosphorylation.
22354785 This review summarizes the regulation and potential function(s) of PRAS40 in the complex Akt- and mTOR-signaling network in health and disease--{REVIEW}
22241085 our findings suggest that PRAS40 promotes the development of ESFT
22090422 study found tuberin and PRAS40 to be potent anti-apoptotic gatekeepers in early stem-cell differentiation; data allow new insights into the regulation of early stem-cell maintenance and differentiation and identify a new role of the tumor suppressor tuberin and the oncogenic protein PRAS40
21914810 dissociation of PRAS40 from insulin-stimulated 4E-BP protein binding to mTORC1 and enhanced mTORC1 substrate binding results from Akt and mTORC1 activation and makes little or no contribution to mTORC1 signaling
21910584 PIM1-activated pPRAS40, AKT-activated pFOXO3a, and their complex formation with 14-3-3 could be key regulators of the radiation-induced radioresistance in NSCLC cells
21906675 PRAS40 is known for its ability to regulate the mammalian target of rapamycin complex 1 kinase activity, possessing a key regulatory role at the cross point of signal transduction pathways activated by growth factor receptors
21886838 phosphorylation of PRAS40 is critical for the activation of mTOR in CNI-induced VEGF overexpression and renal cancer progression.
18372248 after mTORC1 kinase activation by upstream regulators, PRAS40 is phosphorylated directly by mTOR, thus contributing to the relief of PRAS40-mediated substrate competition.
18215133 activation of mTORC1 signalling by phorbol esters does not require PRAS40 to be phosphorylated at Thr(246), bind to 14-3-3 or be released from mTORC1.
17604271 PRAS40 acts downstream of mTORC1 but upstream of its effectors, such as S6K1 and 4E-BP1
17510057 PRAS40 regulates mTORC1 kinase activity by functioning as a direct inhibitor of substrate binding.
17386266 PRAS40 inhibits cell growth, S6K1 phosphorylation, and rheb-induced activation of the mTORC1 pathway
17277771 PRAS40 is an important regulator of insulin sensitivity of the Akt-mTOR pathway and a potential target for the treatment of cancers, insulin resistance and hamartoma syndromes.

AA Sequence

MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIALAHR      1 - 70
AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL     71 - 140
PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP    141 - 210
SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY                            211 - 256
//

Text Mined References (44)

PMID Year Title
26003731 2015 Proline-rich AKT substrate of 40-kDa (PRAS40) in the pathophysiology of cancer.
25648575 2015 Inactivating frameshift mutation of AKT1S1, an mTOR inhibitory gene, in colorectal cancers.
25531317 2015 Transforming growth factor-? promotes prostate bone metastasis through induction of microRNA-96 and activation of the mTOR pathway.
24704832 2015 Nuclear PRAS40 couples the Akt/mTORC1 signaling axis to the RPL11-HDM2-p53 nucleolar stress response pathway.
24576065 2014 Over-expression of PRAS40 enhances insulin sensitivity in skeletal muscle.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23712034 2013 Proline-rich Akt substrate of 40-kDa contains a nuclear export signal.
23460019 2013 Knockdown of PRAS40 inhibits insulin action via proteasome-mediated degradation of IRS1 in primary human skeletal muscle cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22873724 2012 Wnt1 inducible signaling pathway protein 1 (WISP1) targets PRAS40 to govern ?-amyloid apoptotic injury of microglia.
22354785 2012 Role of PRAS40 in Akt and mTOR signaling in health and disease.
22241085 2012 PRAS40 is a functionally critical target for EWS repression in Ewing sarcoma.
22090422 2012 Tuberin and PRAS40 are anti-apoptotic gatekeepers during early human amniotic fluid stem-cell differentiation.
21914810 2011 The mechanism of insulin-stimulated 4E-BP protein binding to mammalian target of rapamycin (mTOR) complex 1 and its contribution to mTOR complex 1 signaling.
21910584 2011 PIM1-activated PRAS40 regulates radioresistance in non-small cell lung cancer cells through interplay with FOXO3a, 14-3-3 and protein phosphatases.
21906675 2012 Proline-rich Akt substrate of 40kDa (PRAS40): a novel downstream target of PI3k/Akt signaling pathway.
21886838 2011 Calcineurin inhibitor-induced and Ras-mediated overexpression of VEGF in renal cancer cells involves mTOR through the regulation of PRAS40.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19648646 2009 Differential 14-3-3 affinity capture reveals new downstream targets of phosphatidylinositol 3-kinase signaling.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18372248 2008 Regulation of proline-rich Akt substrate of 40 kDa (PRAS40) function by mammalian target of rapamycin complex 1 (mTORC1)-mediated phosphorylation.
18215133 2008 The binding of PRAS40 to 14-3-3 proteins is not required for activation of mTORC1 signalling by phorbol esters/ERK.
17979178 2007 A novel tandem affinity purification strategy for the efficient isolation and characterisation of native protein complexes.
17604271 2007 PRAS40 is a target for mammalian target of rapamycin complex 1 and is required for signaling downstream of this complex.
17510057 2007 PRAS40 regulates mTORC1 kinase activity by functioning as a direct inhibitor of substrate binding.
17386266 2007 PRAS40 is an insulin-regulated inhibitor of the mTORC1 protein kinase.
17277771 2007 Insulin signalling to mTOR mediated by the Akt/PKB substrate PRAS40.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16174443 2005 Expression of proline-rich Akt-substrate PRAS40 in cell survival pathway and carcinogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14973226 2004 Neuroprotective role of a proline-rich Akt substrate in apoptotic neuronal cell death after stroke: relationships with nerve growth factor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12524439 2003 Identification of a proline-rich Akt substrate as a 14-3-3 binding partner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.