Property Summary

Ligand Count 725
NCBI Gene PubMed Count 2,660
PubMed Score 20160.10
PubTator Score 8060.70

Knowledge Summary

Patent (545,805)

TINX Plot

  Disease (6)

Disease Target Count
Abnormal lung lobation 10
Abnormal skeletal development 60
Abnormal subcutaneous fat tissue distribution 3
Abnormality of metabolism/homeostasis 134
Abnormality of the penis 7
Abnormally-shaped vertebrae 31
Acquired scoliosis 281
Action Tremor 22
Acute Promyelocytic Leukemia 40
Adult onset 82
Angioid streaks 11
Aortic valve calcification 5
Arachnodactyly 49
Asymmetric chest 4
BREAST-OVARIAN CANCER, FAMILIAL, SUSCEPTIBILITY TO, 1 13
Benign neoplasm of eye, unspecified 3
Big calvaria 147
Bipolar Disorder 666
Blepharoptosis 231
Byzanthine arch palate 194
Cachexia 50
Cafe au lait spots, multiple 17
Calvarial hyperostosis 5
Cardiovascular Abnormalities 31
Cardiovascular Diseases 59
Cataract 297
Cerebellar Ataxia 304
Cognitive delay 608
Colon diverticulum anatomic structure 15
Compression of spinal cord 10
Concave bridge of nose 195
Congenital abnormality of vein 3
Congenital arteriovenous malformation 8
Congenital bronchogenic cyst 3
Congenital deafness 185
Congenital hemihypertrophy 6
Congenital macrodactylia 4
Conjunctival hamartoma 7
Curvature of spine 282
Deafness 198
Decreased muscle mass 28
Decreased projection of maxilla 66
Deep Vein Thrombosis 8
Deficiency of upper jaw bones 66
Depigmentation/hyperpigmentation of skin 1
Depressed nasal bridge 195
Depressed nasal root/bridge 195
Depressive disorder 409
Dermoid choristoma of eye proper 3
Diverticular disease of colon 15
Downward slant of palpebral fissure 158
Dull intelligence 645
Dysgerminoma 11
Enlargement of calvarial bones 5
Enlargement of facial bones 2
Excessive growth of mandibular bone 1
Fibroadenoma of breast 3
Fibrous skin tumor of tuberous sclerosis 18
Fissured tongue 25
Gastrointestinal hamartomatous polyps 10
Global developmental delay 608
Goiter 38
Gynecomastia 64
Hamartoma Syndrome, Multiple 10
Hamartomatous polyp 10
Hearing Loss, Partial 185
Hemangioma 69
Hemangioma, Cavernous 20
Hereditary nonpolyposis colorectal carcinoma 18
Hyperkeratosis 50
Hyperkeratosis, generalized 14
Hyperkyphosis 111
Hyperostosis of facial bones 2
Hyperthyroidism 53
Hypertrophy of facial bones 2
Hypertrophy of skin of soles 1
Hypoplasia of the maxilla 66
Hypoplastic mandible condyle 275
Hypothyroidism 122
Hypotrophic maxilla 66
Impaired cognition 96
Increased gastric cancer 21
Increased head circumference 147
Increased ossification of calvarial bones 5
Increased ossification of facial bones 2
Increased ossification of lower jaw 1
Increased size of cranium 147
Increased size of skull 147
Infantile onset 238
Intellectual disability 1016
Irregular hyperpigmentation 33
Isolated cases 72
Kyphoscoliosis deformity of spine 60
Kyphosis deformity of spine 114
Large auricle 87
Large dysplastic ears 87
Large pinnae 87
Large prominent ears 87
Large protruding ears 87
Large, floppy ears 87
Leg Length Inequality 6
Leiomyosarcoma of uterus 13
Lens Opacities 231
Lipoma 32
Long face 71
Long narrow head 75
Low intelligence 645
Lymphangioma 9
Lymphatic obstruction 21
Lymphedema 42
Macroglossia 65
Macrotia 87
Macule 19
Malignant neoplasm of breast 15
Mammary Neoplasms 425
Mandibular hyperostosis 1
Mandibular hypoplasia 275
Marfanoid body habitus 11
Maxillary retrognathia 66
Melanocytic nevus 43
Mental Depression 333
Mental Retardation 645
Mental and motor retardation 608
Mental deficiency 645
Mental impairment 95
Micrognathism 275
Microstomia 78
Moderate mental retardation (I.Q. 35-49) 28
Mood Disorders 184
Mucosal telangiectasiae 14
Multiple lipomata 7
Multiple, subcutaneous nodules 53
Myopia 176
NEVUS, EPIDERMAL (disorder) 5
Narrow cranium shape 75
Narrow head shape 75
Narrow skull shape 75
Nevus 19
Noncancerous mole 28
Onset of lymphedema around puberty 21
Open mouth 45
Orbital separation excessive 244
Osteochondrodysplasias 72
Ovarian Cysts 41
Ovarian papillary adenocarcinoma 5
Palmoplantar keratosis 74
Papilloma 44
Papule 43
Pectus excavatum 100
Polyp of large intestine 8
Poor school performance 645
Progressive disorder 142
Progressive macrocephaly 18
Pulmonary embolism 55
Renal Cell Carcinoma 214
Retrusion of upper jaw bones 66
Round face 45
Round, full face 45
Sebaceous adenoma 26
Seizures 596
Skin Diseases, Vascular 5
Skin tag 14
Somatic mutation 61
Spinal canal stenosis 12
Splenomegaly 190
Squamous cell carcinoma 129
Squamous cell carcinoma of the head and neck 29
Stomach Neoplasms 300
Strawberry nevus of skin 10
Subcutaneous lipomas 9
Subcutaneous nodule 53
Syndactyly of fingers 48
T-Cell Lymphoma 13
Terminal tremor 20
Testicular Hydrocele 8
Thick lower jaw bone 1
Thin bony cortex 9
Thrombophlebitis 19
Thyroid Gland Follicular Adenoma 9
Thyroiditis 29
Transitional cell carcinoma of bladder 17
Turridolichocephaly 75
Upper limb asymmetry 3
Varicocele 26
Vascular abnormalities restricted to skin 4
Visceral angiomatosis 13
breast carcinoma 1638
hearing impairment 199
ovarian neoplasm 99
Disease Target Count Z-score Confidence
Cancer 2499 8.072 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 2.6e-04
See source...

Protein-protein Interaction (3)

Gene RIF (2522)

AA Sequence

MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRP      1 - 70
NTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAK     71 - 140
PKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFL    141 - 210
TALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENL    211 - 280
MLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFY    281 - 350
NQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK    351 - 420
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA              421 - 480
//

Text Mined References (2686)

PMID Year Title