Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.04
PubTator Score 6.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
nephrosclerosis -1.106 1.1e-02
adrenocortical carcinoma -1.097 2.5e-08
primary pancreatic ductal adenocarcinoma -3.272 3.6e-04
intraductal papillary-mucinous neoplasm ... -1.600 2.3e-02
lung carcinoma 1.100 1.5e-24
gastric carcinoma -2.500 3.2e-02
pancreatic cancer -3.100 1.6e-04

Gene RIF (1)

PMID Text
20453000 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDC      1 - 70
RVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVEL     71 - 140
GLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYK    141 - 210
YEDKNGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGA    211 - 280
HGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVTHECPNYFR                       281 - 331
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18416522 2008 Protection against aflatoxin B1-induced cytotoxicity by expression of the cloned aflatoxin B1-aldehyde reductases rat AKR7A1 and human AKR7A3.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12879023 2003 Aflatoxin B1 aldehyde reductase (AFAR) genes cluster at 1p35-1p36.1 in a region frequently altered in human tumour cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10383892 1999 cDNA cloning, expression and activity of a second human aflatoxin B1-metabolizing member of the aldo-keto reductase superfamily, AKR7A3.