Property Summary

Ligand Count 251
NCBI Gene PubMed Count 145
PubMed Score 388.06
PubTator Score 357.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
lung carcinoma 2843 5.1e-10
malignant mesothelioma 3232 6.7e-08
astrocytoma 1146 2.3e-05
Atopic dermatitis 952 7.2e-05
cystic fibrosis 1696 1.1e-04
medulloblastoma, large-cell 6241 1.1e-04
Amyotrophic lateral sclerosis 451 1.3e-04
breast carcinoma 1638 1.3e-04
acute quadriplegic myopathy 1158 1.6e-04
atypical teratoid / rhabdoid tumor 5112 1.9e-04
lung cancer 4740 2.0e-04
ductal carcinoma in situ 1745 2.1e-04
nasopharyngeal carcinoma 1058 3.7e-04
oligodendroglioma 2850 4.1e-04
pituitary cancer 1972 6.4e-04
posterior fossa group B ependymoma 416 8.4e-04
fascioscapulohumeral muscular dystrophy 100 1.0e-03
interstitial cystitis 2312 1.1e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 1.4e-03
head and neck cancer and chronic obstructive pulmonary disease 239 1.4e-03
osteosarcoma 7950 1.7e-03
fibroadenoma 559 2.3e-03
Duchenne muscular dystrophy 601 3.2e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 510 3.2e-03
invasive ductal carcinoma 2951 3.5e-03
colon cancer 1478 3.8e-03
dermatomyositis 966 4.5e-03
non-small cell lung cancer 2890 6.6e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 7.4e-03
intraductal papillary-mucinous neoplasm (IPMN) 3291 7.4e-03
acute myeloid leukemia 783 7.6e-03
pancreatic cancer 2398 1.0e-02
medulloblastoma 720 1.1e-02
subependymal giant cell astrocytoma 2287 1.8e-02
pterygium 76 1.9e-02
limb girdle muscular dystrophy 2A 213 2.2e-02
nephrosclerosis 333 3.5e-02
glioblastoma 5792 3.8e-02
aldosterone-producing adenoma 665 3.9e-02
Common variable immunodeficiency 101 4.3e-02
head and neck cancer 271 4.9e-02
Disease Target Count Z-score Confidence
Cancer 2499 4.226 2.1

Expression

  Differential Expression (41)

Disease log2 FC p
acute myeloid leukemia -1.300 7.6e-03
acute quadriplegic myopathy 2.873 1.6e-04
aldosterone-producing adenoma -1.490 3.9e-02
Amyotrophic lateral sclerosis 1.854 1.3e-04
astrocytoma 1.200 2.3e-05
Atopic dermatitis -1.800 7.2e-05
atypical teratoid / rhabdoid tumor -2.800 1.9e-04
autosomal dominant Emery-Dreifuss muscul... 2.277 3.2e-03
breast carcinoma -2.600 1.3e-04
colon cancer -1.700 3.8e-03
Common variable immunodeficiency -1.101 4.3e-02
cystic fibrosis 1.308 1.1e-04
dermatomyositis 2.200 4.5e-03
Duchenne muscular dystrophy 1.146 3.2e-03
ductal carcinoma in situ -3.000 2.1e-04
fascioscapulohumeral muscular dystrophy 1.577 1.0e-03
fibroadenoma -2.700 2.3e-03
glioblastoma -1.600 3.8e-02
head and neck cancer -1.300 4.9e-02
head and neck cancer and chronic obstruc... -1.500 1.4e-03
interstitial cystitis -2.500 1.1e-03
intraductal papillary-mucinous adenoma (... 1.800 1.4e-03
intraductal papillary-mucinous neoplasm ... 2.000 7.4e-03
invasive ductal carcinoma -1.710 3.5e-03
limb girdle muscular dystrophy 2A 1.075 2.2e-02
lung cancer 2.200 2.0e-04
lung carcinoma -1.500 5.1e-10
malignant mesothelioma -2.900 6.7e-08
medulloblastoma -1.500 1.1e-02
medulloblastoma, large-cell -3.200 1.1e-04
nasopharyngeal carcinoma -2.800 3.7e-04
nephrosclerosis -1.077 3.5e-02
non-small cell lung cancer 1.178 6.6e-03
oligodendroglioma 1.300 4.1e-04
osteosarcoma -3.001 1.7e-03
pancreatic cancer 1.100 1.0e-02
pancreatic ductal adenocarcinoma liver m... -2.173 7.4e-03
pituitary cancer -1.800 6.4e-04
posterior fossa group B ependymoma 1.700 8.4e-04
pterygium 1.100 1.9e-02
subependymal giant cell astrocytoma 2.968 1.8e-02

 GWAS Trait (1)

Protein-protein Interaction (3)

PDB (43)

Gene RIF (116)

AA Sequence

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA      1 - 70
DGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFD     71 - 140
IVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKD    141 - 210
IVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN    211 - 280
VQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY                               281 - 323
//

Text Mined References (148)

PMID Year Title