Property Summary

Ligand Count 39
NCBI Gene PubMed Count 65
PubMed Score 446.81
PubTator Score 154.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
non-small cell lung cancer 1.051 4.4e-05

 GO Component (1)

Protein-protein Interaction (5)

Gene RIF (45)

AA Sequence

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIA      1 - 70
DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFD     71 - 140
TVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKD    141 - 210
IVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN    211 - 280
VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY                               281 - 323
//

Text Mined References (69)

PMID Year Title