Property Summary

Ligand Count 22
NCBI Gene PubMed Count 67
PubMed Score 1290.06
PubTator Score 216.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.100 2.3e-05

Synonym

Accession Q04828 P52896 Q5SR15 Q7M4N2 Q9UCX2
Symbols C9
DD1
DDH
DDH1
H-37
HBAB
MBAB
HAKRC
DD1/DD2
2-ALPHA-HSD
20-ALPHA-HSD

Gene

PANTHER Protein Class (2)

Protein-protein Interaction (1)

Gene RIF (42)

AA Sequence

MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA      1 - 70
DGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFD     71 - 140
TVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKD    141 - 210
IVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN    211 - 280
VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY                               281 - 323
//

Text Mined References (68)

PMID Year Title