Property Summary

Ligand Count 455
NCBI Gene PubMed Count 153
PubMed Score 1915.84
PubTator Score 343.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ulcerative colitis 1.900 1.9e-04
astrocytoma 1.500 1.5e-02
glioblastoma 1.600 2.7e-03
intraductal papillary-mucinous carcinoma... -1.300 3.0e-02
malignant mesothelioma -2.100 4.1e-08
ovarian cancer -1.400 2.5e-03

Protein-protein Interaction (1)

PDB (137)

Gene RIF (109)

AA Sequence

MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR      1 - 70
EELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILD     71 - 140
TWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAY    141 - 210
SPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFE    211 - 280
LSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF                                      281 - 316
//

Text Mined References (161)

PMID Year Title