Property Summary

NCBI Gene PubMed Count 11
PubMed Score 20.32
PubTator Score 3.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.100 1.1e-02
osteosarcoma 2.565 2.8e-06
group 3 medulloblastoma 1.800 2.4e-02
Atopic dermatitis 1.200 1.0e-04
primary pancreatic ductal adenocarcinoma 1.616 2.2e-03
Breast cancer 2.400 3.4e-02
aldosterone-producing adenoma -1.403 2.8e-02
Polycystic Ovary Syndrome -1.216 1.6e-03
acute myeloid leukemia 1.200 2.5e-03
ulcerative colitis 1.100 7.7e-07
ovarian cancer 1.500 4.9e-05
pancreatic cancer 1.500 1.7e-03

Gene RIF (1)

PMID Text
26036627 Akirin-2 downregulation increases chemosensitivity in human glioblastomas more efficiently than Twist-1

AA Sequence

MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFG      1 - 70
DVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQ     71 - 140
PLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS           141 - 203
//

Text Mined References (15)

PMID Year Title
26036627 2015 Down regulation of Akirin-2 increases chemosensitivity in human glioblastomas more efficiently than Twist-1.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18460465 2008 A novel binding factor of 14-3-3beta functions as a transcriptional repressor and promotes anchorage-independent growth, tumorigenicity, and metastasis.
18066067 2008 Akirins are highly conserved nuclear proteins required for NF-kappaB-dependent gene expression in drosophila and mice.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.